KEGG   Mus musculus (mouse): 71799
Entry
71799             CDS       T01002                                 

Gene name
Ptcd1, 1110069M14Rik
Definition
(RefSeq) pentatricopeptide repeat domain 1
  KO
K17710  pentatricopeptide repeat domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    71799 (Ptcd1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    71799 (Ptcd1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    71799 (Ptcd1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    71799 (Ptcd1)
SSDB
Motif
Pfam: PPR_2 PPR_3 PPR_long PPR PPR_1 MNE1
Other DBs
NCBI-GeneID: 71799
NCBI-ProteinID: NP_598496
MGI: 1919049
Ensembl: ENSMUSG00000029624
Vega: OTTMUSG00000023010
UniProt: Q8C2E4
Position
5; 5 G2
AA seq 695 aa
MDLLRLSRLFSGPRPIGLSVLQHLDLVGSTRWTGGREGPARLRAAFCGSSSPLPLGSGNQ
KEMSSLCSDSSKLSTVAPQEEAEEESFGSLSGKFSSRRIFHKSTAQLYNLQLKEQGGEEE
ELEPRPWRGRRNTQYWYFFQCKRLIKEGKLAEALDLFERQMLKEERLQPLECNYTVLIGG
CGRVGYLKKAFRLFNDMKKRDLEPSDATYTALFNVCAESPWKDSALQSALKLRQQLQARN
FQLNLKTYHALLKVAAKCADLRLCLDVFKEIIQRGHAVTEETFCFLLVGCIQDKKTGFRQ
AMQVWRQMLSLGIKPSRHGYNLLLEAARDCGLGDPEVASRLLLTSQEETILLPPPKGRHM
AGRKVQAKTVHGVSLRHVEALERQLFLEPSQKLEGPPALPEARVTSRTQPEVETTAEPGH
TVALTPLASKPTHLELEVSLLSLGTLSPAVVSFGTVATPADRLALMGGLEGFLGKMTEHG
LQPDIKTLTLLAEVVEPGSTAESSLLSVLDRHRVEADVTFFNTLIRKKSKLGDLEGAKAL
LPILAKKGIVPNLRTFCNLAIGCHRPRDGMQLLADMKKSQVSPNIHIYSTLINAALKKLD
YTYLISILKDMRQNSVPVNEVVVRQLEFAAEYPPTFDRYKGKNTYLEKIDGFRAYYKQWL
KAMPAEEAPHPWQEFQNKPVGDQDTTDKAGGLRDG
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggacctcctaagactctcccggctcttttccggtccccgccccataggactgtctgtc
cttcaacacctggatcttgttggatcaacccgatggacaggaggcagggagggacctgca
cggctgagagctgccttctgcggctcctcctccccgctgcccctgggcagcgggaaccag
aaggaaatgagcagcctctgctctgactccagtaagctcagcactgtggctccccaggag
gaggcagaggaagagagcttcgggagcctctctggcaaattctcctcccggaggatattc
cacaagtcaacggcccagctctacaacctgcagctcaaggaacagggtggtgaggaggaa
gaactggagcccagaccgtggcggggccggaggaacactcagtactggtacttctttcag
tgcaaacgtctgatcaaggaaggaaagcttgcagaggccctggatctgtttgagaggcag
atgctgaaggaagagcgcttgcagcctctggagtgcaactacacggtgctgattgggggc
tgcgggcgcgtcgggtacctgaagaaggctttcagactcttcaatgatatgaagaagaga
gacctggagccctcggatgccacatacacagctctgttcaatgtctgtgcggagtccccc
tggaaggactctgccctgcagagtgccctgaagctccgacagcagctccaggccagaaac
ttccagctcaacctgaaaacgtatcatgccctgctgaaggtggccgccaagtgtgcagac
ctcaggctgtgcctggatgtcttcaaggaaatcatccaaagggggcatgcagtcacagag
gagaccttctgttttctgcttgtgggctgcatccaggacaagaagacaggcttccggcaa
gccatgcaggtgtggcggcagatgctgagtctggggatcaaaccaagtaggcatggctac
aacctcctgttggaggcagctcgagactgtggtctgggggacccagaggttgcctccagg
ctgctcctgacgtcccaggaagagaccatcttgctcccacccccaaagggcaggcatatg
gcagggaggaaagtccaggccaagacagtgcatggtgtgtcactcagacatgtggaagca
ctggagaggcagctgtttctggaaccttctcagaaactcgaggggccaccagcccttcct
gaggccagggtaacaagcaggacccagcctgaggtggaaaccacggcagaacctggccac
acagtagccctcaccccactggcctcgaaacctacccacttggagctggaagtcagtctc
ctaagtcttggaactctctcccccgctgtggtctcatttgggacagtggccacacctgct
gataggctggcgttgatggggggcctggaaggcttcctgggcaagatgaccgaacacggg
ctccagccagacatcaaaaccctcactctgctggctgaggtggtggagcctgggagcact
gcagaatcctcgctgctttccgtcctggacaggcatagggtggaggccgacgtaaccttc
ttcaacacgctgataaggaaaaagagcaaactgggagacctggagggagccaaggcactg
ttgccaatcctggcaaagaagggaattgtccccaatcttcggactttctgcaatctggcc
attggttgccatcggcccagggatggtatgcagctgcttgcagacatgaagaagtcccag
gtgagccctaacatccacatctacagcacccttatcaacgcagccctcaagaagttggac
tacacctatctcatcagcatcctgaaggacatgaggcagaacagcgtcccagtaaacgag
gtggtcgtccgccagctggagtttgcagccgagtaccctcccacctttgaccggtacaaa
ggaaaaaacacctacttggagaagattgatggctttcgggcttattacaagcagtggttg
aaagccatgccagcagaggaagccccccacccctggcaggagttccagaacaagcctgtt
ggggaccaagacaccactgacaaggctggcggccttagggacggatga

DBGET integrated database retrieval system