KEGG   Mus musculus (mouse): 71803
Entry
71803             CDS       T01002                                 

Gene name
Slc25a18, 1500015I14Rik, AW125787
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier), member 18
  KO
K15107  solute carrier family 25 (mitochondrial glutamate transporter), member 18/22
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    71803 (Slc25a18)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   71803 (Slc25a18)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 71803
NCBI-ProteinID: NP_001074517
MGI: 1919053
Ensembl: ENSMUSG00000004902
Vega: OTTMUSG00000056827
UniProt: Q9DB41
Position
6 F1; 6 57.0 cM
AA seq 320 aa
MIACRMSSQDLSISAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYRGMTDCLMKT
ARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGIC
QVVITCPMEMLKIQLQDAGRLAVCHQASASATPTSRPYSTGSTSTHRRPSATLIARELLR
TQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCTAGSVA
AVAVTPLDVLKTRIQTLKKGLGEDTYSGVTDCARKLWTQEGPAAFMKGAGCRALVIAPLF
GIAQGVYFIGIGERILKCFE
NT seq 963 nt   +upstreamnt  +downstreamnt
atgatcgcctgcaggatgtccagccaggacctgagcatctccgcaaaactcatcaatgga
ggtatagcaggtcttgtgggggtgacctgcgtgtttcccattgaccttgccaagacccga
ctacagaaccagcaggggaaagatgtgtacagaggaatgacagattgcctgatgaagact
gcacgtgctgagggcttcctgggcatgtaccgaggggctgcagtaaacctcaccctggtc
actccagagaaggcaatcaagctggcagccaatgacttcttgcggcagctgctcatgcaa
gatgggacgcagcggaacctgaagatggagatgctggccgggtgtggggctggaatatgc
caggtggtgattacctgtcccatggaaatgctcaagattcagctgcaggatgctggccgc
ttagctgtctgtcatcaggcttctgcctcagccacacccacctcccggccctacagcact
ggctcgacttccacccacaggcgcccatcggccaccctcattgcccgggagctgctccgc
actcagggcctctctggtctctacaggggcctgggtgccacgctcctcagggacattccc
ttctccatcatctacttccctttgtttgcaaacctgaaccaactcggagtcagcgagctc
accggcaaggcctccttcacacactcctttgtagcaggctgcacagcaggttctgtggca
gcggtagccgtcacccctctggatgttctgaagactcgaattcagaccctcaagaaaggc
ctgggtgaggacacctacagcggagtcactgactgtgccaggaagctctggacacaggag
gggccagcagccttcatgaaaggagcaggctgccgtgccctggtcatagcccccctcttt
gggatcgcccagggcgtctacttcattggcatcggagagcgcatcttgaagtgctttgag
taa

DBGET integrated database retrieval system