KEGG   Mus musculus (mouse): 71805
Entry
71805             CDS       T01002                                 

Symbol
Nup93, 2410008G02Rik
Name
(RefSeq) nucleoporin 93
  KO
K14309  nuclear pore complex protein Nup93
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    71805 (Nup93)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    71805 (Nup93)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    71805 (Nup93)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     71805 (Nup93)
SSDB
Motif
Pfam: Nic96 Nup84_Nup100 Clathrin
Other DBs
NCBI-GeneID: 71805
NCBI-ProteinID: NP_765998
MGI: 1919055
Ensembl: ENSMUSG00000032939
Vega: OTTMUSG00000061621
UniProt: Q8BJ71
Position
8:94941192..95054728
AA seq 819 aa
MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKA
SVLLGSRGLDISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKR
TFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQESEPSYIGDVNPPGRSSLDS
IEMAYARQIYIYNEKIVSGHLQPNLVDLCASVAELDDKSISDMWAMVKQMTDVVLTPATD
ALKSRSSVEVRMDFVKQALGYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIK
LPAPSPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVSRAQHQLGEFKTWFQEYMNSKD
RRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDITDNQSEVADKTEDYLWLKLNQ
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAIAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCMRRLNFVRLLMLYTRKFE
STDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDK
FTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNK
ERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIDRLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSATRPQRVIED
RDSQLRSQARALITFAGMIPYRTSGDTNARLVQMEVLMN
NT seq 2460 nt   +upstreamnt  +downstreamnt
atggatactgaggggtttggtgagctccttcagcaagctgaacagcttgctgctgagact
gaaggcatctctgagcttccacatgtagaacgaaatttacaggagatccagcaagctggt
gagcgcctgcgttcccgtaccctcacacgcacatcccaggagacagcagatgtcaaggca
tcagttcttctcgggtcaaggggacttgacatatcccatatctcccagagactggagagt
ctgagcgcagccaccacttttgaacctctcgagcctgtgaaggacacggacattcagggc
ttcctgaagaatgagaaagataatgccttgttgtctgctattgaagagtcccggaagagg
acctttggcatggctgaggagtatcatcgagaatcaatgctggtcgagtgggaacaagtg
aaacaaaggattctgcacacactgctggcgtcgggagaggatgcccttgacttcacccaa
gaaagtgagccgagttacatcggtgatgtgaatccccctgggcgaagctctctggatagc
attgagatggcctatgcccggcagatctatatctataacgagaagattgtgagtggacac
ctacagcctaacctggtggacctgtgtgcctctgtcgcagagctggatgacaagagcatt
tctgacatgtgggccatggtaaaacaaatgacagatgtggtgctgacaccagcaactgac
gccctgaagagccggagcagtgtggaagtgcgtatggactttgtcaagcaagccttggga
tatcttgagcagagttataagaattacacccttgtgactgtcttcggaaatctgcatcag
gcacagctgggcggtgtgcctgggacttaccagctggttcggagtttcctaaacattaaa
ctgccagctccttcaccaggacttcaggatggagaggtagaaggccatcctgtctgggca
ttaatttattactgcatgcgctgtggagacctgcttgccgcatcacaagtcgtcagtcga
gcccagcaccagcttggggaatttaaaacttggttccaggagtacatgaacagcaaggat
agaagattgtctccagctacagaaaacaaactccgacttcactaccgcagagccctcagg
aacaacacagacccctacaagagagctgtgtactgtattattgggagatgcgatatcacc
gacaatcagagtgaagtagccgacaagactgaggactacctatggttaaaattgaaccag
gtgtgttttgatgatgacggcaccagctcaccacaagacaggctcactctctcacagttc
cagaagcagctgctagaagactatggcgagtcccacttcacggtgaaccagcagcccttc
ctctactttcaagtgctgttcctgactgcacagtttgaagctgccattgccttcctcttc
cgcatggagcggctgcgctgccatgctgtccatgtggccctggtgctgtttgagctaaag
ctgcttttaaagtcctctggacagagtgctcaactcctcagccacgagcctggcgaccct
ccctgcatgcgacggctgaactttgtgcgtctgctcatgctctacacccgcaagtttgag
tccacggacccaagagaagccctccagtacttttacttcctcagggatgagaaagacagt
caaggagaaaacatgtttctgcgctgtgtgagcgagcttgtgatagaaagtcgagagttt
gatatgattcttggaaaactagagaacgatggaagtagaaagcctggagttatagataag
tttaccagtgacacaaagcctattatcaacaaagttgcttcggtggcagaaaacaaagga
ctgtttgaagaggcagcgaagctttatgaccttgctaagaatgctgacaaggtgctggag
ctgatgaacaagctgctaagccctgttgtcccacagatcagcgccccacagtctaacaaa
gaaaggctgaagaacatggccctctccattgcggagaggtacagagctcagggaataagt
gcaaataagtttgtggactctacattctatctcctcttggacctgatcaccttttttgac
gagtatcacagtggtcatattgacagagcctttgatattattgaccgcttgaagctggtg
cctctgaatcaggagagtgtggaagaaagggtggctgccttcagaaacttcagtgatgaa
atcagacacaacctctcagaagttcttctcgccaccatgaacatcctgttcacacagttt
aagaggctcaaaggaacaagtccatcttcagcaaccaggccccagcgagtcattgaagac
cgtgactctcaactccgaagtcaagccagagccctgattacctttgctgggatgataccg
taccggacgtcgggggacactaatgccaggctggtgcagatggaggtcctcatgaattaa

DBGET integrated database retrieval system