KEGG   Mus musculus (mouse): 71819Help
Entry
71819             CDS       T01002                                 

Gene name
Kif23, 3110001D19Rik, C87313, CHO1, Knsl5, MKLP-1, MKLP1
Definition
(RefSeq) kinesin family member 23
  KO
K17387  kinesin family member 23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    71819 (Kif23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71819 (Kif23)
   03036 Chromosome and associated proteins [BR:mmu03036]
    71819 (Kif23)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    71819 (Kif23)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    71819 (Kif23)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    71819 (Kif23)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     71819 (Kif23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin MKLP1_Arf_bdg Microtub_bd
Motif
Other DBs
NCBI-GeneID: 71819
NCBI-ProteinID: NP_077207
MGI: 1919069
Ensembl: ENSMUSG00000032254
Vega: OTTMUSG00000062532
UniProt: E9Q5G3
Position
9; 9 B
AA seq 953 aa AA seqDB search
MKSAKAKTVRKPVIKKGSQTNLKDPVGVYCRVRPLSFPDQECCVEVINSTTLQLHTPEGY
RLNRNGDYKETQYSFKRVFGTHTTQKELFDVVANPLVDDLIHGKNGLLFTYGVTGSGKTY
TMTGSPGSGGLLPRCLNMIFNSIGSFQAKRYVFKSNDRNSMEIQCEVDALLERQKREALP
IPKTPSSKRQADPEFADMINVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVQFD
PIKPKLPQSKTLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSR
SHSVFSIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTKAEGNRLREAGNI
NQSLMTLRTCMEVLRENQTYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDY
EESLQVMRFAEVTQEVEVARPVDKVICGLTPGRRYRNLPRGGPVGDEPLVPEVILQSFPP
LPPCKLLDINDEETLPKLADTLEKRHHLRQLMTEDLNKKCLAFKALLKEFDNSLSNKENY
VQEKLNEREKVISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELESQNQK
LQRQFSDKRRLEARLQGMVTETSMKWQKECERRVAATQLEMQNKLWVKDEKLKQLKAIVT
EPKPEKPERPSRERDREKIIPRSVSPSPLPLSSNNIAQISNGQQLMSQPQLHRRSNSCSS
ISVASCISEWEQKLSPFSTPVNVTSLARHRQQEPGQSKTCIVSDRRRGMCWTEGREMVPT
FSSEIGVEEDHCRRNTPIPVRHRRSRSAGSRWVDHKPASNVQTETVMQPHVPHAITVSVA
NEKALAKCEKYMLTHQELASDGEIQTKVIKGDVYKTRGGGQSVQFTDIETLKQELPTGSR
KRRSSTLAPAQPDGTESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagcgaaggctaagacggtcagaaaacctgtaataaaaaaaggatctcagaca
aaccttaaagatccagtgggggtgtactgtagggttcgccccctgagctttcctgaccaa
gaatgctgtgtggaagtgatcaatagtacaaccctgcagctccacactcctgagggctat
cgactcaacagaaatggggactataaggagactcagtactcattcaagcgggtatttggc
actcacaccacccagaaggaactttttgatgttgtagctaatcccttggtagatgacctc
attcatggcaagaatggtcttttatttacatatggcgtgacgggaagtggaaaaacctac
acaatgacagggtctccagggtctggaggcctgcttcctcgttgtttgaatatgatcttt
aacagcatagggtcatttcaagcaaaacgttatgtgtttaagtctaatgataggaacagt
atggaaatacagtgtgaagtcgatgccttgttagaacggcagaaaagagaagccttgccc
attccaaagaccccctctagcaagcgacaagcagatccagagtttgcagatatgataaat
gtacaagaattctgcaaagcagaagaagttgatgaagacagtgtctatggagtatttgtc
tcttacattgaaatctataataattacatatatgatctattggaagaagtgcagtttgat
cccataaagcccaaactcccacaatctaaaacgctccgagaagataagaaccacaatatg
tatgtggcaggatgtacagaagtagaagtgaaatctacggaggaggcttttgaggttttc
tggagagggcagaaaaagagacgcattgctaacacccatttgaatagagagtccagtcgt
tcacatagcgtgttcagcattaaacttgtccaggctcccctggatgctgatggagacaat
gtcttacaggaaaaagagcaaattactataagccagctgtctctggtagatcttgctggg
agcgaaagaaccaaccgtactaaagcagaagggaacagactacgtgaggccggaaacatt
aatcagtcattgatgacactaagaacatgcatggaggtcctgagagagaaccagacgtat
ggcactaacaagatggttccatatcgagattcaaagctaacccatctattcaagaactac
ttcgatggggaggggaaagttcggatgatcgtgtgtgtgaatccaaaggctgaagactat
gaagaaagcttgcaagtcatgagatttgctgaagtaacccaagaagtggaagtggcaaga
ccagtggacaaggtgatatgtggcctgacacccgggaggcggtacaggaacctgcctcgg
ggaggccccgttggagatgaacctttggtgcctgaagtgattctacagagcttcccaccg
ctgcccccatgcaagcttttggatatcaatgatgaggagacccttccaaagctggctgac
actttggagaaacgacatcacctgcgacaactaatgaccgaggaccttaacaaaaaatgt
ctagctttcaaggccttattaaaagaatttgacaattctctatcaaataaagaaaactac
gttcaggaaaaactaaatgaaagagaaaaagtgatctcgggacagaaattggaaatagag
cgactggagaagaaaaacaaaactttggagtacaagattgagattctggagaaaacaact
acgatctatgaggaagataagcgcaatctgcagcaggagcttgagagccagaatcagaag
cttcagcggcagttttctgacaagcgcagattagaagccaggttgcaaggcatggtaaca
gaaacgtcgatgaagtggcagaaggaatgtgagcgtcgggtggcagccacccagctagag
atgcagaataaactctgggtcaaagatgaaaagctcaaacagctgaaggccattgtgact
gaacccaaacctgagaagccagagagaccctcccgggagcgggaccgggagaaaatcatt
ccgagatctgtctctccttcgcctctacctctttctagtaacaatattgctcagatttcc
aacggccagcaactcatgagccagccgcagctacacagacgctctaactcttgcagcagc
atttctgtagcttcctgtatctcggaatgggagcagaaactatctccattcagcacacct
gtcaatgtcacctcccttgcaaggcataggcagcaggagccaggacaaagtaaaacgtgt
atcgtgtcagacagaaggcgaggcatgtgctggactgaaggcagggagatggtccccaca
ttcagcagtgagataggcgtagaagaggaccattgccgcaggaacaccccaattcctgta
cgacacagaaggtcccgctctgcagggagcagatgggtagatcataagcctgcctctaat
gtgcaaactgagacagtgatgcagccgcatgtccctcacgccatcacagtgtctgttgca
aatgaaaaggcgctagctaagtgtgagaagtacatgctgacccaccaggaactagcctcc
gatggggagattcagactaaagtcattaagggtgatgtttataagacgagaggtggcgga
caatcggttcagtttactgatattgagactttaaaacaagaattgccaactggtagtcgg
aaacgaagatcgtccaccctagcacctgcccaaccagatggtacagagtctgaatggacc
gatgtagaaacaaggtgctctgttgccgttgaaatgagagcaggatctcagctgggaccg
ggatatcagcaccacgcacaacccaagcgcaagaaaccttga

DBGET integrated database retrieval system