KEGG   Mus musculus (mouse): 71832
Entry
71832             CDS       T01002                                 

Gene name
Csl, 1700007H16Rik
Definition
(RefSeq) citrate synthase like
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    71832 (Csl)
   00630 Glyoxylate and dicarboxylate metabolism
    71832 (Csl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     71832 (Csl)
SSDB
Motif
Pfam: Citrate_synt PAS_3
Other DBs
NCBI-GeneID: 71832
NCBI-ProteinID: NP_082221
MGI: 1919082
Ensembl: ENSMUSG00000046934
UniProt: Q80X68 Q9DAM4
Position
10; 10 D1
AA seq 466 aa
MALLTAAAWFLGTKNPPCLVLAARHASASSTNLKDVLRNLIPKEQARIKTFRKKHGKTVV
GQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKLLPKAKGGKEPLPEGLF
WLLVTGQMPTEEQVSWLSQEWVKRAALPSHVVTMLDNFPTKLHPMSQLSAAITVLNNESN
FARAYAQGMNRTKYWELTYEDCMDLLAKLPCVAAKIYRNLYREDRNIEAIDSKLDWSHNF
TNMLGYTDPQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAALNGLAGPL
HGLANQEVLVWLTQLQKEVGEDASDEKLKNYIWNTLNSGRVVPGYGHAVLRKTDPRYSCQ
REFALKHLPKDPMFKLVGQLYKIVPDILLEQGKAKNPWPNVDAHSGVLLQYYGMREMNYY
TVLFGVSRALGVLSQLIWSRALGFPLERPKSMSTDALMKFVNSESG
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggctctacttactgcggcagcctggttcttgggaaccaaaaacccaccctgccttgtc
cttgccgcccggcatgccagtgcttcttccacgaacttgaaagacgtgctgaggaatctg
atacccaaggagcaagccagaattaagaccttcagaaagaaacacgggaagacagttgtg
ggccagatcactgtggacatgatgtacggtggcatgagaggcatgaagggacttgtgtat
gagacatcggttcttgatcctgatgagggcatccgtttccgaggctacagtatccctgag
tgccagaaactgctgcctaaggctaagggtgggaaagaacccctgcctgagggcttattt
tggctgctggtaactggacagatgcccacagaggaacaggtatcttggctctcacaagaa
tgggtaaaaagggcagctctaccttctcatgtcgtcaccatgctggacaattttccgacc
aaattgcaccccatgtctcagctcagtgcagccatcacagtcctcaacaatgaaagcaac
tttgcccgggcatatgcgcagggaatgaaccgaactaagtactgggagctcacctatgaa
gactgtatggacctgcttgccaagcttccgtgtgttgcagcaaagatctaccggaatctg
taccgggaagataggaatattgaggccattgactctaagctggactggtcccacaatttt
accaacatgttaggctacacggaccctcagttcaccgagctcatgcgtttgtacctcacc
atccacagtgaccatgagggtggtaatgtaagtgcccacaccagccatttggtgggcagt
gccctttctgatccttacctgtcctttgcagcagccttgaatgggctggcggggcctctc
catgggctagcaaatcaggaggtgcttgtctggctgacacagctacagaaggaagttggc
gaagatgcatcagatgagaagttaaaaaactacatctggaacacactcaactcaggacgg
gttgtcccaggctatggccatgcagtactgaggaagactgaccctcgctattcctgtcag
cgagagtttgctctgaaacatctgcctaaggatcccatgttcaagctggttggtcagctg
tacaagattgtacccgatatcctcttagagcaagggaaggctaagaacccttggcccaac
gtagacgctcacagtggggtgctgctccagtactacggcatgagggagatgaattactac
acagtcctgttcggagtgtcgcgggcactgggcgttctgtcccagctcatctggagcaga
gccctaggcttccctctggaaaggcccaagtccatgagcacggatgctctgatgaagttt
gtgaactctgagtcaggataa

DBGET integrated database retrieval system