KEGG   Mus musculus (mouse): 71837
Entry
71837             CDS       T01002                                 

Gene name
1700003E16Rik, AU041756
Definition
(RefSeq) RIKEN cDNA 1700003E16 gene
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: DUF4639
Other DBs
NCBI-GeneID: 71837
NCBI-ProteinID: NP_082224
MGI: 1919087
Ensembl: ENSMUSG00000030030
Vega: OTTMUSG00000057902
UniProt: Q9DAQ4
Position
6; 6 C3
AA seq 598 aa
MSHEGSRQARDRGVTRSKAEKARPPTQPVPQVDIVPGRLNEAEWIAFMSLEEGEDVVGDI
LADLMTRVMECAFKVYLTQQCVPFTISQAREAMLQITEWRFLARDEGESAVAEDPTWGED
EEPLACTTDSWAQGSVPVLHTPAPVCVEEQFHNEEPGNPDQFLLGSSWDKESQKPTQPSE
PSAEPKVTPRPTATLEAFEEAEPGDALEVPHGQEGSHMLAVPSKESLRSTAEGERVYSPQ
SSLKQPQVVRLQASEKESSFGSHLSLEDLYLCMPQPDAAGDRLSLQSKGQLHSSPIGSES
HLGALTPAEPSAFQEPEVLGERPKHKTTTLRMDSSRLPRHWVRPVAEVLIPDLEVHPLEI
YRGRPRRSQAGTATSACESQALSSRAPSKPHVSSPRFPLQRCATFRALGPDPSLNLAQTS
PSFGSNVPFLSPGFRFLPRNPIPPDVASTPTPKLWPLAKWPSGWEREAEQLGELWAGRTR
VPPQGQEPVEVTPLEEDSGWPLAAPQVLEATSQVLWKPMVISETMKLVPGVSMWNRGTQE
LLNPAVIRKEAEEGTPQAPEQQPIQTGVSKPQVIMKQIRNETPKAWLLPTKPVPHSGS
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgagtcacgaaggctcgaggcaggcgcgagatcgtggggtgacccgatccaaggcagaa
aaagcccggccacccacccagccggtgccgcaggtggacatcgtgcctgggagactcaat
gaggcagaatggattgcgtttatgtccctggaggagggcgaggacgtagtgggtgacatc
ttggctgaccttatgactcgagttatggagtgtgccttcaaagtctatctgacccagcag
tgcgttccattcaccattagccaggcccgagaggccatgctgcagatcactgagtggcgc
ttcctggcccgagatgagggagaatctgcagtggctgaggaccccacgtggggagaggat
gaggagcccctggcatgcactacggattcctgggcccagggctccgtgcctgttctgcac
acaccggcgcccgtttgtgtagaggagcagttccacaacgaagaacctgggaacccggac
cagttccttttaggttcatcgtgggacaaagagtcccaaaagccgacacaaccttcagaa
ccttctgccgagcccaaagtcaccccgagacccacggccaccttggaggcgtttgaggaa
gctgagcccggggatgccttggaagtaccccacggccaagagggaagccatatgttggct
gtgccctcgaaggagtctttacgatctacggcggaaggcgagcgcgtctacagcccccag
tcttctctgaagcagccccaagtagtccgtcttcaggcctctgagaaggaatcatccttc
ggctcacacctgtcgctcgaggatctttacctctgcatgccccagccagacgcggcaggg
gaccggctgagcttgcagagcaagggccagctccacagcagcccgatagggtcggagtcc
cacctcggtgcactcaccccggcagagccctccgcgttccaggagcctgaagtcttggga
gagcggccaaagcacaagaccaccacgttgcgcatggattcctcgcggctgccccgccac
tgggtgcgccccgtggccgaggtcctgatcccagacctcgaagtgcaccctttggaaata
tatcgcgggcgcccgcgcaggagccaagctgggaccgcaacctcagcatgcgagtcccaa
gcccttagctcgcgtgctccctccaaaccccatgtctctagcccaaggttccctctccag
cgttgtgctacattccgtgctttgggcccggatcctagtttaaacttggcccaaacctca
ccgtccttcgggtcaaacgtgccattcctcagccccgggttccgcttcctccctagaaac
ccaatccctcccgacgtcgccagcacccctacccccaaactatggcccctagctaagtgg
ccaagtggctgggagcgggaggcggagcagctgggagagctgtgggcgggtcggactcgc
gtgcctccacagggtcaggaacctgtggaggtgacacctttggaggaggactctggatgg
cccctagcggcgccccaggtcctcgaggctacgtcccaagtgctttggaagcccatggtt
atttcagaaaccatgaagctggttcctggtgtgagtatgtggaaccggggaacccaggag
ctgctcaatcctgctgtcatccggaaggaggctgaagaaggcaccccccaggcgcctgag
cagcaacccatccagacaggtgtgtccaagcctcaggtgattatgaaacagataaggaac
gagacccccaaagcctggctgctccccaccaagcctgtgccccactctgggtcctga

DBGET integrated database retrieval system