KEGG   Mus musculus (mouse): 71840
Entry
71840             CDS       T01002                                 

Gene name
Tekt4, 1700010L19Rik
Definition
(RefSeq) tektin 4
  KO
K18631  tektin-4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    71840 (Tekt4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     71840 (Tekt4)
SSDB
Motif
Pfam: Tektin Med9 Mating_N Baculo_PEP_C APG6_N BST2 DUF445 TMF_DNA_bd
Other DBs
NCBI-GeneID: 71840
NCBI-ProteinID: NP_082227
MGI: 1919090
Ensembl: ENSMUSG00000024175
Vega: OTTMUSG00000035768
UniProt: Q149S1
Position
17; 17 A3.3
AA seq 447 aa
MAQTGVLLTKEPAPQSIDVCELPRKEYEVACNTGAYTSSGLATAGFRTAKYLRDEWFQNS
YARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQRE
IDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKET
ELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQF
YPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAV
NSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQR
SHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKT
NSLFIDRQKCMTHRNRYPSVLQLAGYQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcccaaacgggcgtgctcctgaccaaggagccggccccacagtcaatagatgtctgt
gagcttccgcgcaaagaatatgaagtggcctgcaatactggcgcctacacgtcctcgggt
ctggccaccgctggcttccgcacagccaaatacctgagggacgagtggtttcagaactct
tatgcccgctaccaccaggccttcgcagaccgggactactctgagcggcagcggcatgag
agcgggcagctggtagccgagactggggcactggcccagcgcacacaacttgactccaca
agaaaggtgggagagcgcctggaggacatgcattgctggaagtcagagctgcagcgagag
atagacgagctgtcttccgagacggacctgatgatggcccagaagctgcggctacagcgc
gccttggatgccacctccgtgccttactccattgctactgacaacctgcagtgcagagaa
cgccgccagcacccagaccttgtccgggactatgtggaggtggagctactgaaggaaacc
gagctgatcaggaacatccaggaactcctgaagaggacgataggacaagccgtggaccag
atacggctgaacagggagcataaggagtcgtgtgagatgaactggtcggacaaagtggaa
gtctacaacattgacgatacctgctcccgctacaccaatgagagcacccaggtgcagttc
tatccgcattccagcaagttcgaggagagtgcttccacgcccgagacgtgggccaagttc
aatcacgacaacctgcttcgagccgagcgcgagcggctagcctcggttaacctgcggaag
ttaattgactgcatcttgcgggatacggccgaggacctgcggctacagtgcgatgcagtg
aactcggctttctcaagccgctgccaagagctggacgactcactccagaagctgcagtac
caccttcgaaagaccctgacggagatcacagaccaggaacaccagattgcagccttgaag
caggccatcaaggacaaggaggcccctctgcgtgtggcccagactcgcctttaccagcgg
tcacaccggcccaatgtggagttgtgccgggacaatgcccagttcaggttgctgagcgag
gtggaggagttgaacatgtccctcagagcgttaaaggagaagcttcaggatgcggagcag
gcactgcggaacctggaggattcacgcatgagtctggagaaggacatcgcagtcaagacc
aacagcctctttatcgaccgccagaagtgtatgacccaccgcaaccgctaccccagtgtc
ctccagctggctggctaccagtga

DBGET integrated database retrieval system