KEGG   Mus musculus (mouse): 71843
Entry
71843             CDS       T01002                                 

Gene name
R3hcc1, 1700020M16Rik, AA407796
Definition
(RefSeq) R3H domain and coiled-coil containing 1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: R3H NCBP3 Nop14 Dicty_REP
Other DBs
NCBI-GeneID: 71843
NCBI-ProteinID: NP_001139484
MGI: 1919093
Ensembl: ENSMUSG00000034194
Vega: OTTMUSG00000029904
UniProt: Q8BSI6
Position
14 D2; 14 36.08 cM
AA seq 488 aa
MALLCLDGVFLSSAENDFVHRVQEELDRFLLQKQLSKVLLFPPVSSRLRYLIHRTAENFD
LLSSFSVGEGWKRRTVICHLDIRVPSSDGPSGPCRPPASHPSKYRGPRYTSHQGAAAGPR
GAPAGRWHRGRKPDQPLYVPRVLRRQGGPVAASIPGIKGEDPAGAVSEEEPREAGAGDAE
ADQGIAMLVTQELLKSPDPGHANEPQMGLGDTEPSENPEKEQGAETAVQQGSGAQLAMEE
ENRSHGMRSLVDQEEEEIEGEEEEKVDEKEEDTGKQKERVDEEEEKTDAQEGKVDSEGER
MDEGEDKVDAEEEDEDEADADHGDFSELLQEITANLTEKEIKIEKIHLDTSAFTEELPGE
RDLTHLVEIYDFKPTLKTEDLLATFSEFQEKGFRIQWVDDTHAIGIFPCPASALEALAKD
FSVLKIRPLTQGTKQSKLKALQRPKFLRLSKERPQTDSAVARRLVARALGLQHNRKKELP
TPPSVLPS
NT seq 1467 nt   +upstreamnt  +downstreamnt
ctggcccttctctgcttggacggtgtcttcctctcctcggccgaaaatgactttgtccac
cgggtccaagaggagctcgatcgtttcctgctgcagaagcagctatccaaggtcctactt
tttcccccagtctccagccgcctgcggtacctgatccatcgaacggcggagaattttgat
cttttgagcagcttctctgttggggagggctggaagaggaggacagtcatttgtcacctg
gacatcagagtacccagttcagatggcccctctggtccctgccgccctcctgcctcccat
cccagcaagtaccgtggtcctcggtatacctcacatcagggagcagctgctggtccccga
ggtgctccagcaggacgctggcatcgtggacggaagccggatcagcctctgtatgtgccc
cgggtgctacgcaggcaaggtggaccggtggcagcctccatcccaggcatcaagggagag
gacccagctggtgcagtgtcagaagaagagcctagagaggctggtgctggggacgctgag
gctgatcagggaattgccatgttggtgactcaagagctcctgaagagccccgacccaggc
catgcaaatgagccacagatggggttgggtgacacggagccctctgagaatcctgaaaag
gaacaaggggctgagacagctgtgcagcaggggtccggcgcacaactggccatggaggag
gaaaataggagtcatgggatgcggagcctggtggaccaagaggaggaggagatagaggga
gaggaggaagagaaggtggacgagaaggaagaggacacaggcaagcagaaagagcgggtc
gatgaggaggaagagaagactgatgcgcaggaagggaaggtggattcggagggagagagg
atggatgaaggtgaagacaaggtggatgcggaggaagaggacgaggatgaggccgatgct
gaccacggtgatttcagtgagctgctgcaggagatcacagccaacctgaccgaaaaggag
attaaaatagagaagatccacctggacacatccgccttcacagaagagctgcccggggag
agggacttgacccacctggtggagatctatgactttaagccaacactcaagaccgaggac
ctgttggccactttctctgagttccaagagaagggattcagaatccagtgggtggatgac
actcatgctatcggcatctttccctgccctgcctcagcactcgaggcactggccaaggat
ttctccgtgctcaagatccgcccgctcacacaggggaccaagcagtccaagctgaaagcc
ttgcagaggccaaagttcctgcgactatcgaaggagaggccgcagacagattcagcggtg
gcccgcaggctggtggcccgggccttgggactccaacacaacagaaagaaagagctgcct
actcccccaagtgttctgccatcttga

DBGET integrated database retrieval system