KEGG   Mus musculus (mouse): 71856Help
Entry
71856             CDS       T01002                                 

Gene name
Wfdc3, 1700015L13Rik, 1700127F16Rik
Definition
(RefSeq) WAP four-disulfide core domain 3
  KO
K23637  WAP four-disulfide core domain protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    71856 (Wfdc3)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I17: WAP-type family
   71856 (Wfdc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WAP
Motif
Other DBs
NCBI-GeneID: 71856
NCBI-ProteinID: NP_082237
MGI: 1923897
Ensembl: ENSMUSG00000076434
Vega: OTTMUSG00000001099
UniProt: Q14AE4
Position
2; 2 H3
AA seq 130 aa AA seqDB search
MKALLALGFLASWVAAGEHALRGECPADPLPCQELCTGDESCPQGHKCCSTGCGHACRGD
IEGGRDGQCPRILVGLCIVQCMMDENCQSGERCCKSGCGRFCIPGLQPLQQLKDSNLTDG
FNSKLEAQAP
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacttcttgctcttgggttcctggcatcttgggtagctgcaggagagcacgca
ttgagaggtgaatgtccggctgaccctcttccatgtcaggagctgtgtaccggagacgaa
tcctgtccccaggggcacaaatgctgcagcacagggtgtggccatgcctgccgcggagac
atcgagggagggcgggatggtcaatgtcccagaatcctggtaggcctgtgtattgtccag
tgcatgatggatgagaactgtcaatccggggaaaggtgctgtaagtcaggctgcggccgc
ttctgcatcccaggactccagcccctccaacagctcaaagactccaacctgactgatggc
tttaattctaaactggaggctcaagcgccctag

DBGET integrated database retrieval system