KEGG   Mus musculus (house mouse): 71861
Entry
71861             CDS       T01002                                 
Symbol
Zswim2, 1700025P14Rik, 4933437F18Rik, MEX
Name
(RefSeq) zinc finger SWIM-type containing 2
  KO
K15716  E3 ubiquitin-protein ligase ZSWIM2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    71861 (Zswim2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     71861 (Zswim2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    71861 (Zswim2)
SSDB
Motif
Pfam: zf-RING_2 SWIM zf-RING_11 zf-C3HC4_2 zf-C3HC4 zf-rbx1 ZZ zf-ANAPC11 zf-RING_5
Other DBs
NCBI-GeneID: 71861
NCBI-ProteinID: NP_082240
MGI: 1919111
Ensembl: ENSMUSG00000034552
UniProt: Q9D9X6 Q0VB10
Position
2:complement(83745423..83771596)
AA seq 631 aa
MLRGGCKASEKRRHLSESLSWQQDQALSSSIYLLRQIGPTGFLLKEEEPEKGDFRVLLGN
PHECSCPTFLKRGELCKHICWVLLKKFKLPRNHESAFQLGLTEGEINDLLRGIHQVQAPQ
LRASDETAQVEEDGYLKQKDINAGDICPICQEVLLEKKLPVTFCRFGCGNNVHIKCMRIL
ANYQDTGSDSSVLRCPLCREEFAPLKVILEEFKNSNKLITISEKERLDKHLGIPCNNCNQ
LPIEGRCYKCTECVEYHLCQECFDSCCHSSHAFASREKRNQRWRSVEKRSEVMKYLNTEN
EGEAKPGCFQEKQGQFYTPKHVVKSLPLLMITKKSKLLAPGYQCRLCLKSFSFGQYTRLL
PCTHKFHRKCIDNWLLHKCNSCPIDRQVIYNPLIWKGIATDGQAHQLASSKDIACLSKQQ
EPKLFIPGTGLVLKGKRMGVLPSIPQYNSKVLTTLQNPSDNYQNITMDDLCSVKLDNSNS
RKLVFGYKISKQFPTYLKNPTTGQTPSQTFLPSLPHKNIICLTGRESPHIYEKDHIGQSQ
KTSRGYEHINYNTRKSLGSRLRQHKRSSALSSEDLNLTINLGTTKLSLSKRQNNSMGKVR
QKLGHPPRRPAYPPLQTQNAALSLIMQGIQL
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgcttcgcggaggctgtaaagcctcagaaaagcgaagacacttaagcgagagcctcagc
tggcagcaagaccaggcgctgagtagcagcatctatctcctgcgacagatcggccccaca
ggcttcctactgaaggaggaggagccagaaaagggggatttccgagttttgcttggaaac
ccacatgagtgcagctgccccacgtttctgaagaggggggaactgtgcaagcacatatgc
tgggtgttattgaaaaaattcaagcttccaaggaatcatgaatctgcttttcagttgggt
cttaccgaaggagaaataaatgacttgctccgggggatacatcaggtccaagctccacag
cttagagcaagtgatgagactgcacaggtggaagaagacggctaccttaagcagaaggac
atcaatgcaggggatatctgtcctatttgtcaagaagtgctgctggagaaaaaactccct
gtcaccttctgcagatttggttgtggcaataatgttcacataaaatgcatgcggatcttg
gctaactaccaagacacagggtctgacagttccgtgttaagatgtccgctgtgcagagaa
gagtttgcaccactaaaagttatcttggaggagttcaaaaactctaacaaactcataact
atatctgagaaagaacgactggacaaacacctcggaattccctgtaataactgtaaccaa
ctgccaatcgaggggaggtgctacaagtgtactgagtgtgtggagtaccacttatgccag
gagtgctttgacagctgctgtcactcttcccatgcctttgcgtcccgtgagaaaagaaac
caaagatggagatcagtagaaaaaagatcagaagtcatgaaatatttaaatactgaaaat
gagggtgaagcaaagccgggatgttttcaagaaaagcagggtcagttttacacaccgaag
catgttgtaaagtctctgcctctcctgatgattacaaagaagagcaagctgctggcccca
gggtaccagtgtcgactttgcttgaaatcattttcttttggtcaatatacaagactgcta
ccatgtactcacaagtttcacaggaaatgtattgacaattggttactccacaagtgcaat
tcatgcccgattgacagacaagtcatatataaccctctgatctggaaaggcatagccacg
gatggacaagcacatcagttggcttcaagcaaagatatcgcctgtctgtcgaagcagcaa
gagccaaaactttttattcctggtactggattagttttaaaaggaaagagaatgggggtt
ttacctagcattccccagtataattctaaagtattgactacacttcaaaatccatcagac
aactatcagaatataacaatggacgacctatgctcagtcaaattagataattcaaattcc
agaaaattagtttttggatataaaattagcaaacagttccccacatatctgaaaaatcca
accactgggcaaacaccatctcaaacatttcttccttcccttcctcataagaacattatt
tgtctcactggaagggaaagcccacatatctatgaaaaagatcatattggtcagagtcaa
aagacaagcagaggttacgaacatataaactataacacaaggaaatctcttggttctaga
ttaagacaacacaagagatcaagtgcattatcttcagaagatttaaatcttactatcaac
ttgggtacaaccaaacttagtttgtctaagaggcaaaataattccatggggaaagttaga
caaaaacttggtcatccacccagacgacctgcgtatccccctttacaaacacaaaatgct
gctctgtctttaataatgcaaggaattcaactctga

DBGET integrated database retrieval system