KEGG   Mus musculus (mouse): 71862Help
Entry
71862             CDS       T01002                                 

Gene name
Gpr160, 1700025D19Rik, GPCR150
Definition
(RefSeq) G protein-coupled receptor 160
  KO
K08438  G protein-coupled receptor 160
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    71862 (Gpr160)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    71862 (Gpr160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1211
Motif
Other DBs
NCBI-GeneID: 71862
NCBI-ProteinID: NP_001127857
MGI: 1919112
Ensembl: ENSMUSG00000037661
Vega: OTTMUSG00000022043
UniProt: Q3U3F9
Position
3; 3 A3
AA seq 336 aa AA seqDB search
MTALSSKNCSLQYQLHQSPQLLEASCLLFLIILGKVLLNILLLRVRRGDARWTLMEYFCF
SLALVDLLLLVNISILTYFRDFVVLGIRFTRYHICLLTQIISFTYGFLHYPVCSLACIDY
WCNLSRASKQSSRWQKLLYFLTVILTWISVLAYVLVDPAISVSLKAHRGYVYQCPAYVST
QSHWLSLSMLMVLFVAFLISWQEVVALLQAMRIASYKSKAALYFPFPLHCGYALSCREAL
LPRLIVCFLGTWFPFVALQVLILSLRVQIPAYIEMNVPWLYFVNSFLIAAVYWFNCHKLD
LRDSSLPVDPFINWKCCFVPVHRLKQVERPMSIVIC
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacagctctttcttcaaagaactgctctcttcaataccagctccatcagtctccgcag
ctcctggaggcctcctgtctgttgttcttgatcatcctggggaaagtgttattaaacatc
ctccttctaagagtgagaaggggagacgcccgctggactttgatggagtacttctgcttc
tcactcgcacttgtcgatctcctgctgttggtaaacatttccatcctgacctacttcagg
gactttgtagttctaggtattaggtttaccagataccacatctgtctgctcacacaaatt
atttccttcacttatggcttcttgcattacccagtctgctcactggcttgtatagactac
tggtgtaatctgtccagagccagcaagcagtcatctaggtggcagaaattactttatttc
ttgacagtcattttaacttggatctcagtccttgcttacgttttggttgacccggccatc
tcagtcagcctaaaggcacacaggggctatgtgtaccagtgccccgcctatgtcagcact
cagagtcactggctctcactgtctatgctgatggttttatttgtggcttttctgatttca
tggcaggaagttgttgccttgcttcaggctatgaggatagcatcctataagagcaaggcc
gccctctactttcctttcccactccactgcggttacgccctgagctgcagagaagcactc
ttgcccaggctcatcgtgtgctttcttgggacctggtttccctttgtagcacttcaggtc
ctcatcctctccctcagagttcagatcccggcgtacatagaaatgaacgtcccctggctg
tactttgtcaacagtttcctcatcgctgcagtttattggtttaactgccacaagcttgat
ttaagagacagctcgttacctgtggatcctttcatcaactggaaatgctgctttgttcca
gtccatagacttaagcaagtggagaggcccatgtccatagtcatctgttag

DBGET integrated database retrieval system