KEGG   Mus musculus (house mouse): 71874
Entry
71874             CDS       T01002                                 
Symbol
Mab21l4, 2310007B03Rik
Name
(RefSeq) mab-21-like 4
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Mab-21_C Mab-21
Other DBs
NCBI-GeneID: 71874
NCBI-ProteinID: NP_001153412
MGI: 1919124
Ensembl: ENSMUSG00000034159
UniProt: Q8CEZ4
Position
1:complement(93079076..93088679)
AA seq 452 aa
MPGSEMPAPCVFAPDMAEQVPLWHHYLLAIQSRESPRVQDYQRAENILLTVLERVHALDS
RFIVDYSRDLEAFQFALRSSEDPLDVEVLLGVDSEALLIEESEATEPGDGPAICRLGVLK
EASGLEPWMTADIFSVSSEDRDKCCGHLVPSKVLCVLKDLLVAAIVHCKHHRLIPPGSLN
AANLKEGQMRLSLLVSSGWRKIRFNVVPVVRKKHRVPALEGAQLKLGFPEGILRRIASHG
VDLVPANAQHWRISTGYLLSRLLDALGSLPGHRLDSLSILDRVNLESWQGGSQNHGLTFD
HLKTVLLWASTLFPAPEDWADLQGSVYRQLVVLLCCLATRKLPHFLYPEHNLLQDGGLDL
GAIYQRVEHFASQPEESLRIHVTHLGPSRPPRIDNGVKALLQLPASDPTYWATAYFDFLL
DKFQVFNIQDKDRISAMQNIFQKTKTMGSENS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcctggctcagagatgcctgctccctgtgtctttgctccagacatggcggagcaggtg
cccctgtggcatcactacctgttggccatccagtcacgggagtcaccccgtgtccaggac
taccagagagcggagaatatcttgcttacggtgctggaacgcgtccatgccttggactcc
cgcttcattgttgactattctagagacctggaggccttccagtttgccctgcgttcctca
gaggacccactggatgtggaggtgctcctgggggtggattcggaggctctcctgatcgag
gagtcagaagccactgagccaggggatggccctgcaatctgtcgcctgggtgtcctcaag
gaggcatctggcctggagccatggatgactgctgacatcttcagtgtctcctcagaggac
agagacaagtgctgtggccaccttgtacccagtaaagtcctgtgtgtcctcaaagatctt
ctggtggctgccattgtacattgcaagcaccacaggctcattccaccaggttcactgaat
gctgctaatctgaaggaagggcagatgcgcctgtctctgctggtgtccagtggctggagg
aagatccgcttcaacgttgtgcccgtggtgaggaagaagcaccgggtgcctgccttggag
ggggcccagttgaagcttggatttcctgagggcatcttgagaagaattgccagccacggg
gtggacctggtaccagctaatgcccagcactggaggatctccactggctacctgctcagt
cgcctgcttgatgcactaggctccctccctggccaccgcctggacagcctctccattctc
gaccgcgtaaacctagaaagttggcaaggtggcagccagaaccatggcctaacttttgac
cacctgaagacagtgctgctgtgggcctctacgctgttcccagcaccagaggactgggct
gacctgcagggctcagtgtaccgccagctggtggtgctgctctgctgcctggctaccagg
aagctgccccacttcctgtacccggagcacaacttgctgcaggatggtggcctggacctt
ggcgccatctaccaacgagtagaacacttcgccagccagcccgaagagtccttacgaatc
catgtcacccacctgggccccagccgtccaccacgcatcgacaatggtgtcaaagcgcta
ctgcagctcccagccagcgaccctacctactgggccaccgcctactttgactttctgcta
gataagttccaggtcttcaacatccaggataaggacagaatctcagccatgcagaacatc
ttccagaagaccaagaccatggggagtgagaacagctga

DBGET integrated database retrieval system