KEGG   Mus musculus (mouse): 71877
Entry
71877             CDS       T01002                                 

Gene name
Efhc1, 1700029F22Rik, mRib72, mRib72-1, myoc, myoclonin1
Definition
(RefSeq) EF-hand domain (C-terminal) containing 1
  KO
K23029  EF-hand domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    71877 (Efhc1)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    71877 (Efhc1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     71877 (Efhc1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   71877 (Efhc1)
SSDB
Motif
Pfam: DUF1126 EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5
Other DBs
NCBI-GeneID: 71877
NCBI-ProteinID: NP_082250
MGI: 1919127
Ensembl: ENSMUSG00000041809
Vega: OTTMUSG00000029838
UniProt: Q9D9T8 B2CKC6
Position
1; 1 A4
AA seq 648 aa
MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQA
ELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHV
NIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKT
FRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRKEPVRKYVTPSDFDQLKQFLTFDK
QVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKV
LVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFG
MPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVL
RYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVD
NPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPEL
PAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSCKENLRETFQMYDKDESG
YVDRETFFKICETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSN
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggggaccaacccggtgcacggcctgccctttctcccgggctcgtcctttacagactcc
acgaaaacagcattccaccgaagccagacactcaactacaggaacggctatgcagttgtc
cgacgtcccaccatggggataggtggagaccggctccactacaaccagctgtctcaggcc
gagctggatgaactggccaataaggcacccatcttaacttacgggccactcaagcaagcc
ccacttgcagagtttgttcctgcgcatgtggcttttgacaaaaaggtgctgaaatttagt
gcctacttccaagaagatgttcccatatcaatggaggagcattaccgaatccgccacgtg
aacatttactactacctagaagatgacagcatgtctgtcatcgagcccgtagtggagaac
tctgggatcccacaaggcaagctaatcaaacgccagcggttcaccaagaatgatatggga
gaccactaccactggaaggacctcaaccgtggaatcaaccttacagtgtacggcaaaacc
ttccgaattgttgactgtgaccgattcactcaggactttttggaaagccaaggcattgaa
ttaaatccatcagagaagatacccctggatccttacactcaactccggaaagaacctgtg
cgcaaatatgtcaccccgtcagactttgaccaactgaaacagtttctcacctttgacaaa
caggtccttcgattctatgccatctgggacgacacggatagcttgttcggggaatgtcgt
cactacatcattcattactacctcatggatgacaccgtggagatcagagaggtccacgaa
cggaacaacgggagagaccccttcccactcctcatgaaccgacagcgtatgcccaaagtt
ttggtggagaatgcaaagaatttcccgaagtgtgtgctggaaatctcagaccaagaggtg
ctggagtggtacactgccaaggacttcattgtggggaagccgctcaccatcctggggagg
accttcttcatctacgactgtgacccattcacacgacagttctacaaagacaagtttgga
atgcctgacttaccaccagttgatgtgaccaagaaggagccacctccagtaaaacaggag
ttgcctccttataatggctatggactaattgaagactctgctcagaattgttttgctctc
attcctaaagctcccagaaaagatgtcgttaaaatgctgatgaatgacaataaggtgctc
cgctacctggcggccctggaatcccctatcccagaagacaaagaccgtcggtttgtcttc
tcttattttcttgccacggatatgatcagtatctttgagccacctgttcgaaattctggg
atcatcgggggcaaattcctgggcaggactaaagttgttaaatcattctctccagttgac
aaccccatctactactcaccaagtgacttcttcatcggtgccgtgattgaggtgttcggc
catcggttcgtcatcctcgatacagatgagtatgttttaaaatacatggagagcaacgct
tcccagtattcaccagaagccctggcctcaattcagaaccggatccagaagccggagctt
cccgcaccagaactggaaagcaagcaagctacaggagaacccatggtgcagggtacagag
gaatccaaggtgcaggacttggatgcactgatagaccaaatccatatgcacctgaaatac
aattcatgcaaagaaaacctccgtgaaacatttcaaatgtatgacaaggatgaatcggga
tatgtggacagagagacgttctttaaaatctgtgaaactcttaatgtcccggtcgatgac
tcgttgattaaggagttgatcaggctgtgcacccacggagaaggcaggattaactactat
aactttgttcgagctttctcgaactga

DBGET integrated database retrieval system