KEGG   Mus musculus (house mouse): 71881
Entry
71881             CDS       T01002                                 
Symbol
Apmap, 2310001A20Rik, AI314817
Name
(RefSeq) adipocyte plasma membrane associated protein
  KO
K21407  adipocyte plasma membrane-associated protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71881 (Apmap)
Membrane trafficking [BR:mmu04131]
 Others
  Rab GTPases of specific organelles
   Lipid droplets
    71881 (Apmap)
SSDB
Motif
Pfam: Str_synth SGL SSL_N Arylesterase
Other DBs
NCBI-GeneID: 71881
NCBI-ProteinID: NP_082253
MGI: 1919131
Ensembl: ENSMUSG00000033096
UniProt: Q9D7N9
Position
2:complement(150425000..150450487)
AA seq 415 aa
MSEADGLRQRRPLRPQVVTDDGQVPEVKEGSSFSGRVFRMTFLMLAVSLAIPLLGAMMLL
ESPIDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPESIVNIGDVLFTGTADGRV
VKLENGEIETIARFGSGPCKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQKRS
VKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLE
YDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENM
PGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRY
SLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPFICRLSLQSI
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgagcgaagcggacgggctgcggcagcgtcggcccctgcggccgcaggtcgtcacggac
gatggccaggtcccggaggtcaaggagggcagttcctttagtggcagagtcttcagaatg
accttcttgatgctggctgtgtcccttgccattcccctacttggagccatgatgctgttg
gagtcccccatagatcctcagagtttcagcttcaaagaaccccctttcatgtttggtgtt
ctgcatccaaatacgaagttgcggcaagcagaaaggctatttgaaaaccaacttagtgga
ccagaatccatagtaaatattggggatgtgctgtttactggtacagcagatggccgagtt
gtaaaacttgaaaatggagaaatagagaccatcgctcggttcggttcaggcccttgcaaa
acccgagatgatgaacctacctgtgggagacccctgggcatccgggcagggcccaatggg
actctttttgtggttgatgcgtacaagggactgttcgaagtaaatcctcagaaacgttca
gtgaaactgctgctatcctctgagacgcccattgagggcaagaagatgtcctttgtgaat
gacctcactgttactcgggatggaaggaagatttatttcacggattccagcagcaagtgg
cagagacgagactacctgcttctggtgatggaggccactgatgatgggcgcctgttagag
tatgatactgtgacgaaagaagtgaaggttttgttggaccagttgcagttccctaatgga
gttcagctctctcctgaggaagactttgtcctagtggcagagacaactatggccaggata
cgaagagtctatgtgtctggcctgatgaaaggaggggcagatatgtttgtggagaacatg
cctggatttcctgacaatatccggcctagcagctctggcggatactgggttgctgctgca
accattcgtgctaaccctgggttttccatgttggatttcttatctgacaagccttttatt
aagagaatgatttttaagatgttcagtcaggagacagtgatgaagtttgtgccacgatat
agcctggtcctagaagtcagtgacagtggtgccttccggagaagcctgcatgatcctgat
ggacaggtggtcacctatgtgagtgaggcgcatgaacatgatggatacctgtacctgggc
tccttcagatctcccttcatctgcagactcagtctccagtctatttag

DBGET integrated database retrieval system