KEGG   Mus musculus (mouse): 71898
Entry
71898             CDS       T01002                                 

Gene name
Apol9b, 2310016F22Rik
Definition
(RefSeq) apolipoprotein L 9b
  KO
K14480  apolipoprotein L
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    71898 (Apol9b)
SSDB
Motif
Pfam: ApoL SseC
Other DBs
NCBI-GeneID: 71898
NCBI-ProteinID: NP_001162131
MGI: 1919148
Ensembl: ENSMUSG00000068246
UniProt: Q8C7I4
Position
15; 15 E1
AA seq 310 aa
MASSGYLYSLVAEDGAWQAFVSKAKLSRERAVALHKALRELTALLAIADRGRLQKGLKGR
EKFLKVFPRLKAELVEHISQLHALADHAEKLHRGCTISNVVADSFSAASDILSLLGLFLA
PVTAEGSLVLSATGLGLGVAATVTDVATSIVEETSRVLDEVEAALTGTHVLGEAGTSVAR
IVNKIPQATRDITRDLEALEQHMNALRLVRANPRLEEDARILATTGSISAQRAMQVRARL
EGTPLAMSNEARIQRAATAGAALWSDVDSLVKESKHLYEGSASESAEALRKLARELEEKL
EGLMEFYKTI
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcaagcagtggatacctgtatagcctggtggctgaagatggagcctggcaggcgttt
gtatccaaggccaagttgtccagggagagagcagtggccctccacaaagctctgagggaa
ctgacagcgctcttggccatagcagacagaggcagacttcaaaaaggtctgaaaggcagg
gagaagtttttgaaagtctttcctcgcttgaaagcagagctggtggagcatatcagtcag
ctccatgccctggctgaccacgctgagaaactacacaggggctgcaccatctccaacgtg
gtggctgactccttcagtgctgcctctgacatcctgagcctccttggtctctttctggca
cctgtgacagcagagggaagtctggtgctctcagcaactggcttggggctgggggtagca
gctactgtgactgatgttgctacctcaatcgtggaggaaacaagcagggttttggatgaa
gttgaagctgctctgactggcactcatgtgctgggggaggctggcacaagtgtagctagg
attgtcaacaagatccctcaggctaccagagacatcaccagagacctggaagcccttgag
cagcacatgaatgccctcaggctggttagagctaaccctcgtttagaagaagatgccagg
atcctggccaccacaggaagcatctctgcccaacgggctatgcaggtgcgggccaggctg
gaaggaacccctctggcaatgagcaatgaagcccggatccaacgtgccgccaccgcaggt
gccgccctctggagtgacgtggacagccttgtcaaagagtcaaagcatctgtacgaaggg
tctgcgtcagagtcggctgaagcactgaggaagctggctcgagagctggaggagaagcta
gaggggctcatggaattctacaagacgatctga

DBGET integrated database retrieval system