KEGG   Mus musculus (mouse): 71902
Entry
71902             CDS       T01002                                 

Gene name
Cand1, 2310038O07Rik, 6330512O03Rik, AI195005, AI846556, D10Ertd516, D10Ertd516e, Tp120a, mKIAA0829
Definition
(RefSeq) cullin associated and neddylation disassociated 1
  KO
K17263  cullin-associated NEDD8-dissociated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    71902 (Cand1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    71902 (Cand1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    71902 (Cand1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   71902 (Cand1)
SSDB
Motif
Pfam: TIP120 HEAT_2 HEAT_EZ HEAT UME Vac14_Fab1_bd CLASP_N Adaptin_N Cnd1 Telomere_reg-2 MMS19_C RTP1_C1 DUF3385 VHS V-ATPase_H_C Uso1_p115_head RRN3
Other DBs
NCBI-GeneID: 71902
NCBI-ProteinID: NP_082270
MGI: 1261820
Ensembl: ENSMUSG00000020114
Vega: OTTMUSG00000030921
UniProt: Q6ZQ38
Position
10 D2; 10 67.08 cM
AA seq 1230 aa
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILRLLEDK
NGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPA
SSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCL
LPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSELSKNDSMSTTRTYIQCIAA
ISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINI
CLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAV
VSTRHEMLPEFYKTVSPALIARFKEREENVKADVFHAYLSLLKQTRPVQSWLCDPDAMEQ
GDTPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGI
IFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEAL
LVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVKERAISCMGQIICNL
GDNLGPDLSNTLQIFLERLKNEITRLTTVKALTLIAGSPLKIDLRPVLGEGVPILASFLR
KNQRALKLGTLSALDILIKNYSDSLTAAMIDAVLDELPPLISESDMHVSQMAISFLTTLA
KVYPSSLSKISGSILNELIGLVRSPLLQGGALSAMLDFFQALVVTGTNNLGYMDLLRMLT
GPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALL
SLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEIT
SQPKRQYLLLHSLKEIISSASVAGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTL
IDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDL
NVRRVALVTFNSAAHNKPSLIRDLLDSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLD
IRKAAFECMYTLLDSCLDRLDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQ
RLDRLVEPLRATCTTKVKANSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQS
QISSNPELAAIFESIQKDSSSTNLESMDTS
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggcgagcgcttcgtaccacatctccaacttgctggagaaaatgacatccagcgacaag
gacttcaggttcatggcgaccaacgacctgatgacagagctgcagaaagactctatcaag
ctggacgatgacagcgagaggaaagttgtgaagatgattctcaggttgctggaggataaa
aatggcgaagtgcagaacttagctgtcaaatgccttggccctttggtgagtaaagtgaaa
gagtaccaagtggagacgatcgtggacaccctctgcaccaacatgctttctgacaaggag
cagctgcgagacatttccagcatcggcctgaaaacagtaattggagaacttccgccagct
tccagtggctctgcattagctgctaatgtatgtaaaaagattactggacgccttaccagt
gcaatagcaaagcaggaagatgtttctgttcagctcgaagccttggatatcatggctgac
atgttgagcaggcaaggaggactgcttgttaatttccacccttcaattctgacctgtctg
cttccccagctgaccagccctagacttgcagtgaggaaaagaacaattattgctcttggc
cacctagttatgagctgcggaaatatagtttttgtagaccttattgaacatctgttgtca
gagttgtccaaaaatgactccatgtcaacaacaaggacctacatacagtgtattgctgct
attagtaggcaagctggccatagaataggtgaataccttgaaaagataattcctttggtg
gtaaaattttgtaatgtagatgatgatgaattaagagaatactgcattcaagcttttgaa
tcatttgtgagaagatgccctaaagaagtttatcctcatgtttctaccattataaacatt
tgtctaaaataccttacctatgatccaaattacaattacgatgatgaagatgaagatgag
aatgctatggatgctgacggtggggacgacgatgaccaagggagtgacgatgaatatagt
gacgatgacgacatgagttggaaagtgagacgcgcggctgctaagtgcctggacgctgta
gttagcacacggcatgagatgctcccggagttctacaagactgtctctcctgcgctgata
gccagatttaaagagcgggaagaaaatgtaaaggcagatgtttttcatgcatacctgtct
cttctgaaacaaactcgtccagtgcaaagttggctgtgtgaccctgacgcaatggagcag
ggagacacgcccctaacaatgctgcagagtcaggttcccaacattgttaaagccctgcac
aagcagatgaaagagaagagtgtgaagacccgacagtgttgctttaacatgttaactgag
ctggtaaatgtgctgccgggagcactaacccagcacattcctgtactggtaccaggaatc
attttctcactgaatgataagtccagctcatcaaacctgaagattgatgcgctgtcgtgt
ctgtatgtcatcctctgtaaccactctcctcaagttttccatcctcatgttcaggctctg
gtccctccggtggtggcctgtgtgggagacccgttttacaagatcacttcagaagccctt
cttgtcactcagcagcttgtcaaagtgatccgtcctctagaccagccctcttcgttcgat
gcaacgccttacatcaaagatctcttcacctgcacaattaagcgcttaaaagcagctgac
attgatcaagaagtcaaggaaagggctatttcctgtatgggacagattatttgcaatctt
ggagacaatttgggtcctgatttatcaaataccctacagattttcttggagagactcaag
aatgagattacccggctaacgaccgtcaaagcgctgaccctgattgctgggtcacctttg
aagatagatctgaggcctgtgctgggagagggagtccccatccttgcttcattcctcagg
aaaaatcagagagctttgaaactggggaccctctctgccctggatattctcattaagaac
tacagtgacagcctgacggccgccatgattgacgcagttctggatgagctcccccccctc
atcagcgagagcgatatgcacgtgtcgcagatggctatcagcttcctcaccaccctggcc
aaggtctatccctcctccctgtccaagataagcggatctatcctcaatgaactgattgga
cttgtgagatcgcctctactgcagggaggagcgctcagtgccatgctagactttttccaa
gctctggttgtcactggaacaaacaatctagggtacatggacttgctgcgcatgctaacg
ggtccagtttattctcagagcactgctctcactcataagcagtcttattattccattgcc
aaatgtgtagctgcccttactcgagcttgccctaaagagggacccgccgtagtaggtcag
tttattcaagatgtcaagaactcaaggtctacagattccattcgtctcttagcactcctt
tctcttggagaagttggacaccatattgacttaagtgggcagttggaattaaaatctgta
atattagaggctttctcatcccctagtgaagaagtcaaatcagctgcgtcctatgcatta
ggcagcattagtgtaggcaaccttcctgagtatctgccctttgtactgcaagaaataacc
agccagcccaaaaggcagtatcttctgcttcactctttgaaggagatcattagctctgca
tcggtggcaggccttaagccatatgttgagaacatctgggccttgctgctaaagcactgt
gagtgtgcggaggaaggcaccaggaatgtcgtggctgaatgtctagggaagctcactctt
attgatcctgaaactctcctcccacggcttaaagggtatttgatatcagggtcatcatat
gccaggagctcggtggttacagctgtgaagttcacgatttctgatcatcctcagcctatt
gatccactgttgaagaactgcataggtgactttctaaaaactttggaagacccagatttg
aacgtaagaagagtggccttggtcacattcaattctgcggcccataacaagccatcactg
atacgggaccttctggactcagttcttccacatctttacaatgagacaaaagttaggaag
gaacttataagagaggtagaaatgggtccatttaaacacacggttgatgacggtctagac
attagaaaggcagcttttgagtgtatgtatacacttctagacagctgtcttgatagactg
gatatctttgaatttctaaatcatgttgaagatggtttgaaggaccattatgatattaag
atgctaacatttttaatgttggtacgactgtctaccctctgtccaagtgcagtactacaa
aggctggaccgacttgttgagccactgcgtgctacgtgtacaactaaggtaaaggcaaac
tctgtaaagcaggagtttgaaaagcaagatgagctaaagcggtctgccatgagggcagtg
gcggctttgttaaccattccagaggcagagaagagccctcttatgagtgaattccagtca
cagatcagctccaacccggagctggcagccatctttgaaagtatccagaaagattcttcg
tccaccaacttggaatcaatggacacgagttag

DBGET integrated database retrieval system