KEGG   Mus musculus (mouse): 71907Help
Entry
71907             CDS       T01002                                 

Gene name
Serpina9, 2310014L03Rik, AW049635, Centerin
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9
  KO
K04525  serpin A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    71907 (Serpina9)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   71907 (Serpina9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 71907
NCBI-ProteinID: NP_082273
MGI: 1919157
Ensembl: ENSMUSG00000058260
Vega: OTTMUSG00000035417
UniProt: Q9D7D2
Position
12; 12 E
AA seq 418 aa AA seqDB search
MGSSSFYRVLLLVGFCAPIFCMLSSNPYNQESSHLPSMKKNPASQVSPSNTRFSFLLYQR
LAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGFNFTWVSEPTIHMGFEYLV
RSLNKCHQGRELRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFSNAATAQAQINSY
VEKETKGKVVDVIQDLDSQTAMVLVNHIFFKANWTQPFSTANTNKSFPFLLSKGTTVHVP
MMHQTESFAFGVDKELGCSILQMDYRGDAVAFFVLPGKGKMRQLEKSLSARRLRKWSRSL
QKRWIKVFIPKFSISASYNLETILPKMGIRDAFNSNADFSGITKTHFLQVSKAAHKAVLD
VSEEGTEAAAATTTKLIVRSRDTPSSIIAFKEPFLILLLDKNTESVLFLGKVENPRKM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggctcttcttccttttaccgagttctcctattggttggcttctgtgctccaatattc
tgcatgttgtcatccaatccctacaaccaagagtcctcccaccttccctctatgaagaaa
aacccggcctcccaggtgtctcccagcaacaccagattctccttcctcctgtaccagagg
ctggctcaggaaaacccaggtcagaatatcctcttttctcctgtgagtatctctacctcc
ctggccatgctgtccctaggggcccgctcagccaccaagacacagatcctccggactctt
ggcttcaacttcacgtgggtttcggagcccaccatccacatgggcttcgagtacctcgtc
cgctcactaaacaagtgccaccaaggccgggaattgcggatgggcagcgtcctcttcatc
aggaaggagctacagctgcaggccacgtttctggacagggtcaagaagctttacggggca
aaagtcttttctgaagacttctcaaatgctgccaccgcccaggcccagatcaacagttat
gtggaaaaggagaccaaagggaaggtggtggatgtaatccaagaccttgactctcagaca
gccatggtcctggtgaaccacatcttctttaaagccaactggacccagccttttagtact
gcaaacacaaacaagagcttcccattcctcctgagcaagggcaccactgtacatgttccc
atgatgcaccagaccgagtcgtttgcttttggagtggacaaggagctaggctgctctatt
ctgcagatggactacaggggagatgctgtggccttctttgtcctccctggcaagggcaag
atgaggcagctggagaaaagtctgtctgccaggaggctaaggaagtggagccgctcactc
cagaaaagatggatcaaggtgttcattccaaaattttccatctctgcttcctacaacctg
gaaaccatcctccccaagatgggaatccgcgatgcctttaactcaaacgctgacttctcc
ggaattacaaagacacacttcctgcaggtttctaaggctgctcacaaggctgtgctggac
gtcagcgaggaggggacagaagccgcggcagccaccaccaccaaacttatagtccgctca
agggacaccccgtcttctatcattgccttcaaggaacccttcctgattctacttctagat
aaaaacacagaatctgttctctttctagggaaagttgaaaaccccaggaagatgtag

DBGET integrated database retrieval system