KEGG   Mus musculus (house mouse): 71924
Entry
71924             CDS       T01002                                 
Symbol
Tube1, 2310061K05Rik, AI551343, Tube
Name
(RefSeq) tubulin, epsilon 1
  KO
K10391  tubulin epsilon
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    71924 (Tube1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    71924 (Tube1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Other tubulins
     71924 (Tube1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    71924 (Tube1)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_2 Tubulin_3
Other DBs
NCBI-GeneID: 71924
NCBI-ProteinID: NP_082282
MGI: 1919174
Ensembl: ENSMUSG00000019845
UniProt: Q9D6T1
Position
10:39009946..39035863
AA seq 475 aa
MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDDAISSFFRNVDTRAVGDGGSIS
KGRISSLKARAVLIDMEEGVVNEILQGPLRDVFDSKQLITDISGSGNNWAVGHKVFGCLY
REQILEKLRKSAEQCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTAVYPS
SEDDVITSPYNSMLAMKELNEHADCVLPIDNQSLFDIISKIDLVVNSGKLGSAVKPKSLI
TSNMGAVKKHHKKPFDAMNNIVANLLLSLTSSARFEGSLNMDLNEISMNLVPFPKLHYLV
SSLTPLYTLADVNIPPRRLDQMFSDAFSKDHQLIQADPRHSLYLACALIVRGNVQISDLR
RNIERLKPALQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELRERFTRLY
KKKAHLHHYLQVDGMEESTFTEAVSSLSALIQEYSDLDATKSLPVPDVPRLSVAL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgacccagtcggtggtcgtacaggtcggacagtgcgggaaccagatcggctgctgcttc
tgggacctggcgctgagggagcacgcagcggtcaaccagaaaggaatttatgacgacgct
ataagcagcttcttcaggaatgtggataccagagctgttggggatggtggcagtatttcc
aaaggaagaatatcttctctaaaagcacgggctgttttgattgacatggaagaaggcgta
gtgaatgaaattctccaaggcccactgagagacgtgtttgatagcaaacagctcatcact
gatatctctggctcgggaaataattgggctgtgggtcacaaagtttttggatgtctttac
cgggaacagattttagagaaactgcggaagtcggcagagcagtgcgattgcttacagtgc
ttcttcatcatccactccatgggcggaggaacaggctctgggcttggcacatttctgtta
aaggttcttgaagatgaattcccagaagtgtaccggtttgtgacagcggtttatccttcc
agtgaagacgatgtcatcacctcgccttataacagtatgctggccatgaaggaactgaat
gagcatgcagactgtgtgctgcccattgacaaccaatctttatttgacatcattagcaaa
attgatcttgtggtaaattctggaaagttgggctcagctgtgaagcctaagagtctcatt
acgtcgaacatgggggctgttaaaaagcaccacaagaagcccttcgacgccatgaacaac
attgtggcgaacctgctcctcagcctgacaagctctgcgaggtttgagggctccctcaat
atggacctgaatgagatcagcatgaacttggttcctttcccgaagcttcattatctcgtg
tcaagcctgacacctctgtacacgctggccgatgttaacattcccccccgaagactggat
cagatgttttcagacgcctttagtaaggatcaccagctcatccaagcagaccccagacat
agcctctaccttgcctgtgccctcatcgttagaggaaacgtacagatttccgatcttcgc
agaaatattgaaagattaaaacctgctctgcagtttgtctcctggaatcaagaaggctgg
aagaccagcctgtgttctgtaccgcctgtgggccactcgcattctctgttagctttagca
aataacacgtgtgtgaagcctaccttcatggagctgagagaaaggttcacaaggctctac
aagaaaaaggctcacctccatcactacctgcaagttgatgggatggaggaaagcactttt
acggaagctgtgtcctctctgtcagcgctcatacaggagtacagtgacctcgatgccaca
aagagcctgcctgtgccagatgtgcccaggttgagtgtggccttgtga

DBGET integrated database retrieval system