KEGG   Mus musculus (mouse): 71927
Entry
71927             CDS       T01002                                 

Gene name
Itfg1, 2310047C21Rik, AI314457, Cda08, D8Wsu49, D8Wsu49e
Definition
(RefSeq) integrin alpha FG-GAP repeat containing 1
  KO
K17257  integrin alpha FG-GAP repeat containing protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    71927 (Itfg1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   71927 (Itfg1)
SSDB
Motif
Pfam: VCBS FG-GAP K1 DUF2681
Other DBs
NCBI-GeneID: 71927
NCBI-ProteinID: NP_082283
MGI: 106419
Ensembl: ENSMUSG00000031703
Vega: OTTMUSG00000061424
UniProt: Q99KW9
Position
8 C3; 8 41.61 cM
AA seq 610 aa
MAAGRLPSARAVLAPLFLGLALLSVGPAPARALHNVTAELFGAEAWGTLAAFGDLNSDKQ
TDLFVLRERNDLIVFLADQSAPYFKPKVKVSLKTLSALVTSVVPGDYDGDSQMDVLLTYF
PQNHTNSELGAVIFWGQNQTLDPKNMTILNRTFHDQPLIMDFNGDLIPDVFGITNESSQP
QILLGGDLSWHPALTTKSKMRDPHSHAFIDLTEDFTADLFLTTLTASNAFQFEIWENLGG
NFSIHSVFEKPKNLVVVGQSAFADFDGDGHMDHLLPGCEDKDCQKSAIYLMRSGTGQWVP
VLQDFSNKGTLWGFVPFVHEEQPTTIPIPLTLHIGDYNMDGYPDALAILKNTSGSNQQAF
LLENVPCNNASCEEVHRMFKVYWDLAGLNLIKDAIVATFFDIYEDGILDIIVLSKGYTKN
DVAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGYLKN
GSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLFVGIPRPSGEKSIRKQEWTAIIPNSQL
IVIPYPHNVPRSWSAKLYLTPSNIVLLTAVALIGVCIFILAIIAILHWQEKKADDREKRQ
EAHRFHFDAM
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggcggcaggccggcttcctagcgccagggcggtgctggccccgctgttcttggggctc
gcgctgctgagcgttgggcctgccccggcgcgggctctgcacaacgtcacggccgagctc
tttggggctgaggcctggggcaccctggcggccttcggtgacctcaactccgacaaacag
acggacctcttcgtgctgcgggaaagaaatgacttaattgtcttcttggcagatcagagt
gcaccctattttaaacccaaggtaaaggtatccctgaagactttgagtgcgttggtaaca
agtgtggtccctggtgattatgatggggattcacaaatggatgtcctgctcacatacttt
ccccaaaatcataccaacagtgaactaggagctgttatcttttggggacaaaatcaaaca
ttagatcctaaaaacatgaccatactcaataggacttttcatgaccaaccactgattatg
gacttcaatggtgatctaattcctgatgtgtttggtatcacaaatgaatccagccaaccg
cagatactgctaggaggagatttatcatggcatcctgccttgaccactaagagtaaaatg
cgagatccacattcccatgcatttattgatctgactgaagattttacagcagatttattc
ctcacgacattgactgcctctaatgccttccagtttgagatatgggaaaatttgggtgga
aacttctctatccatagtgtctttgaaaaacctaaaaatctggtggtggttggacagtca
gcatttgcagactttgatggagatggacacatggatcacttgctgccaggctgtgaagat
aaggactgtcagaaaagtgccatatatttaatgagatctggaacaggacagtgggttcct
gtgcttcaggattttagcaataagggtacactctggggctttgtgccatttgtgcatgaa
gaacaaccaaccacaataccaatcccactcacacttcacattggagactacaacatggac
ggctacccagatgctctggctatattgaagaatacatctggaagcaatcagcaagccttt
ttactggagaacgtcccatgcaataatgcgagctgcgaagaagtgcatcggatgtttaaa
gtctactgggacctagcaggcctaaatctaatcaaagacgccatagttgccacctttttt
gatatttatgaagatggaatcttggacattatagtcctcagtaaaggatacaccaagaat
gatgttgccatccatacactcaaaaataactttgaggcagatgcttactttgttaaagtc
attgttcttagtggtctatgttctaatgactgtcctcgtaagataacaccttttggagta
aatcagcctggaccttatatcatgtacacaacagtagatgcaaatggatatctgaaaaac
ggctcagctggacagctcagccagtcagcacacttagctcttcagctaccttacaatgta
cttggcttaggccgaagtgccaatttcctggatcatctttttgttggtattccccgtcca
tctggagagaagtctataagaaaacaagagtggacagcaatcattccaaattcccagctg
attgtcattccatatcctcacaatgtccctcgaagctggagtgccaaattgtacctgaca
ccaagtaacattgtcctgctgactgcggtagccctcattggagtctgcatttttatcctg
gcaataatcgccattttacattggcaggaaaagaaagccgatgacagagaaaaacgacag
gaagcacatcggtttcattttgatgctatgtga

DBGET integrated database retrieval system