KEGG   Mus musculus (mouse): 71934Help
Entry
71934             CDS       T01002                                 

Gene name
Car13, 2310075C21Rik, Ca13
Definition
(RefSeq) carbonic anhydrase 13
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    71934 (Car13)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     71934 (Car13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 71934
NCBI-ProteinID: NP_078771
MGI: 1931322
Ensembl: ENSMUSG00000027555
Vega: OTTMUSG00000026447
UniProt: Q9D6N1
Position
3; 3 A1
AA seq 262 aa AA seqDB search
MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggctgagctgggggtacggcgagcacaacggtcccattcactggaatgaattg
ttccctattgctgatggtgatcagcagtctccaattgagattaaaaccaaagaagtgaaa
tacgactcctcactccgacctctcagtatcaagtatgatcctgcctcagctaaaatcatc
agcaatagtggccattccttcaacgttgactttgacgacacggaggacaaatcagttctg
cgtggaggtcctctcactgggaactacaggttgcggcagttccatttgcactgggggtca
gcagatgatcatggctcagagcatgtggtagacggagtgaggtatgctgcagagctgcat
gttgtccactggaattcagacaaatacccgagctttgtagaggcagctcatgagtccgat
gggctggctgtcctgggagtatttctacagattggggaacacaatcctcaactgcaaaag
atcactgatattttggattccataaaggaaaagggtaaacaaacacggttcacaaatttt
gacccgttatgcttgcttccatcatcttgggactactggacataccctggctctctgaca
gttccacctcttcttgagagtgtcacgtggattgttttaaaacaacctataagtatcagc
tctcaacagctggccagattccgaagcctcttgtgcacagctgagggagagagtgcggct
tttttgttaagcaatcaccgtccaccacagcccttgaagggccgcagagtgagagcatct
ttctattag

DBGET integrated database retrieval system