KEGG   Mus musculus (mouse): 71949Help
Entry
71949             CDS       T01002                                 

Gene name
Cers5, 2310081H14Rik, AU045339, AW544927, Lass5, Trh4
Definition
(RefSeq) ceramide synthase 5
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
Module
mmu_M00094  Ceramide biosynthesis
mmu_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    71949 (Cers5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    71949 (Cers5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     71949 (Cers5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain DUF1003
Motif
Other DBs
NCBI-GeneID: 71949
NCBI-ProteinID: NP_082291
MGI: 1919199
Ensembl: ENSMUSG00000023021
Vega: OTTMUSG00000042003
UniProt: Q9D6K9
Structure
PDB: 

Position
15; 15 F1
AA seq 414 aa AA seqDB search
MATAAAETLGLLWGWLWSESFWLPQNVSWADLEGPGDGYGYPRAQHVLSVFPLAVCIFSV
RMLFERFIAKPCALRVGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVR
KIQCWFRHRRNQDKPPTLTKFCESMWRFTYYLCIFCYGIRFLWSMPWFWDTRQCWYNYPY
QPLSRELYYYYITQLAFYWSLMFSQFIDVKRKDFLMMFIHHMIGIMLTTFSYVNNMVRVG
ALIFCLHDFADPLLEAAKMANYARRERLCTTLFVIFGAAFIVSRLAIFPLWILNTTLFES
WEIIGPYPSWWLFNALLLILQVLHAIWSYLIVQTASKALSRGKVSKDDRSDVESSSEEED
ETTHKNNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFRASPHLHSCD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcagcagcggaaaccctgggcctcctgtggggttggctgtggagcgagagc
ttctggctgcctcagaacgtgagctgggcggacctggagggcccgggcgacggctacggc
tacccgcgcgcccagcacgtgctgtcggtgttcccgctggcagtgtgcatcttctccgtg
aggatgctgtttgagcgatttattgccaagccctgtgcactccgtgttggcattaaagac
agtcctgtcaataaggtggaacccaatgacacccttgagaaggtgttcgtatctgttact
aagtatcctgatgagaaaaggttgaagggcctatcaaagcaactggactggagtgttcga
aaaatccaatgctggtttcgccatcggaggaatcaggacaagcctccaacgctcacgaaa
ttctgtgaaagcatgtggagattcacttattatttatgtatcttctgctacggaatcaga
tttctctggtcgatgccttggttctgggatacccgacagtgctggtacaactatccgtat
cagccactctcgagagagctgtattactattacatcacacaactggctttctactggtct
cttatgttttctcagtttatagatgttaaaagaaaggacttcctgatgatgtttattcat
catatgattggcattatgctcaccactttctcctacgtcaacaacatggtgcgagtggga
gcactcatcttctgtctgcatgacttcgcagaccccttactggaagctgccaagatggcc
aattatgccagacgtgagcggctctgtaccaccctttttgtgatctttggcgcagctttt
atagtttctcgtctagcaatcttcccattgtggattctgaacacaaccctctttgaaagc
tgggagattattgggccctacccttcctggtggctcttcaatgcccttctcctgatcctg
caggtgctccatgccatctggtcctacctaattgtccagactgcttccaaagccttgagc
cggggaaaggtgtctaaggatgaccgcagtgatgtagagagcagctcagaggaagaagat
gagacaacccacaaaaacaacctctctggcagcagctctagcaatggtgccaactgcatg
aacggctacatgggaggcagccacttggctgaagagcaggggacttgtaaagccactggc
aacctacattttagggcctccccacatctacactcctgtgactag

DBGET integrated database retrieval system