KEGG   Mus musculus (house mouse): 71952
Entry
71952             CDS       T01002                                 
Symbol
Riox1, 2410016O06Rik, MAPJD, NO66
Name
(RefSeq) ribosomal oxygenase 1
  KO
K16914  protein-L-histidine (3S)-3-hydroxylase / [histone H3]-trimethyl-L-lysine4/36 demethylase [EC:1.14.11.79 1.14.11.67 1.14.11.69]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    71952 (Riox1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    71952 (Riox1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.67  [histone H3]-trimethyl-L-lysine4 demethylase
     71952 (Riox1)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     71952 (Riox1)
    1.14.11.79  protein-L-histidine (3S)-3-hydroxylase
     71952 (Riox1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    71952 (Riox1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    71952 (Riox1)
SSDB
Motif
Pfam: JmjC_2 Cupin_8 Cupin_1 Cupin_2
Other DBs
NCBI-GeneID: 71952
NCBI-ProteinID: NP_076122
MGI: 1919202
Ensembl: ENSMUSG00000046791
UniProt: Q9JJF3
Position
12:83997382..83999727
AA seq 603 aa
MDELPNGNGAALLKRGRGRRRRHPQSQPRGASVLALPLRPRKIRRHRKSAAASRVAALRA
RALRSEDSDSKVAVASVRGKRKRPAELLEASRSAEPRPVSARPRSASATLPSRVEGWAAL
SRNLGTAAPPPPGSHADEPGRPRASPLQQVLTELNGIPSSRRRAARLFEWLLAPLPPDHF
YRRLWEREAVLVRRQDRSYYEGLFSTADLDSMLRYEDVQFGQHLDAARYVDGRRETLNPP
GRALPAAAWSLYRAGCSLRLLCPQAFSPTVWQFLAVLQEQFGSMAGSNVYLTPPDSQGFA
PHYDDIEAFVLQLEGRKLWRVYRPRDPSEELALTSSPNFSQEDLGEPVLQTVLEPGDLLY
FPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAVLPLAVQAAIEENVEFRRGLPRDF
MDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRE
RALSVHGLPVRWEAGEPVNVGAQLTTETQVHMLQDGVARLVGEGGRLFLYHTVENSRVYH
LEEPKCLEIHPQQADAMELLLRSYPEFVRVGDLPCDSVEDQLSLATMLYDKGLLLTKTPL
VPS
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggacgagctaccgaatggcaacggtgcggcgctgctgaagcgcgggcgggggaggcgc
cggcggcacccgcagtcgcagccccgcggcgcgtcggtcttggccctgcccttgcggccc
cggaagatccgaaggcaccggaaaagtgcggcggcgtcccgcgtggccgcgctgagagct
cgcgcgctccggagcgaggactcggactcgaaagtggcggtggcctcggttcggggcaag
cggaagaggccggcagagctgctggaggcctcgcggtcggcggagccgcggccggtgtca
gcgcgcccgaggtcggcttcggcgacgctgccgagccgcgtggagggatgggctgcgctc
tcccggaacctggggacggccgctccgccgccgccgggctcgcacgcggatgagccgggg
cgaccccgggcttcgccgctgcagcaggtactgacggagctgaacggcatccccagcagc
cggaggcgcgccgcccgcctcttcgagtggctcctggcgcccctgcctccggaccacttc
taccggcggctgtgggagcgggaggcggtgctggtgcggcggcaggaccgcagctactac
gagggtctcttctccaccgccgacctggactcgatgctgcgctacgaggacgtgcaattc
gggcagcatctggacgccgcgcgctacgtcgatggacggcgggagaccttgaacccgccg
ggccgcgcgcttcccgccgccgcgtggtccttgtaccgagccggctgctccttgcgcctc
ctgtgcccgcaagccttctcgcccaccgtgtggcagtttctggccgtgctccaggagcag
tttggcagcatggcgggctccaacgtctacctcacgcccccggactcgcagggctttgct
cctcactacgatgacatcgaggctttcgtgttgcagctggaaggtcggaaactctggcgc
gtctaccgaccgcgggacccgagtgaggagttggccctgacatctagtcccaacttcagc
caggaggaccttggtgagcctgtgctgcaaacggtactggaacctggagacctgctctat
tttcctcggggcttcattcaccaagctgaatgtcaggatggagtccactccctacacctc
accttgtccacctaccagcgcaatacatggggtgacttcctggaggctgtactgcctctg
gcagtgcaagcggccatagaggagaacgtggagttccgcagaggcttgccccgagacttc
atggattacatgggggcccagcattccgactctaaggatcctagaaggacagctttcatg
gaaaaggtgcgggtcttggttgctcgcctgggacactttgctcctgtcgatgctgtggct
gaccagagagcaaaagacttcattcacgattccctgccccctgtgttgaccgatagggaa
cgggctctaagtgttcacgggctcccagttcgctgggaggctggagaacccgtcaatgtg
ggggcccagctgacaactgaaacccaagtccacatgcttcaggacggcgtagctcggctg
gtgggagagggaggccgattgttcctgtatcacacggtggaaaactctcgagtttatcac
ctagaggaacccaagtgcttagaaatccacccccagcaagccgacgccatggaactcttg
cttcgctcctacccggagtttgtgagagtgggggacttgccatgtgacagtgtggaagac
cagctctccttggcaaccatgttatatgataaggggctgctactcaccaagacacctcta
gttccgagttag

DBGET integrated database retrieval system