KEGG   Mus musculus (mouse): 71967Help
Entry
71967             CDS       T01002                                 

Gene name
Mageb16, 2410003J06Rik
Definition
(RefSeq) melanoma antigen family B, 16
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE Spore_coat_CotO DUF3098
Motif
Other DBs
NCBI-GeneID: 71967
NCBI-ProteinID: NP_001107206
MGI: 1919217
Ensembl: ENSMUSG00000046942
Vega: OTTMUSG00000017908
UniProt: Q9CWV4
Position
X B; X
AA seq 363 aa AA seqDB search
MSQSSEECAADQGQTCEETQKLQVAAASIDVEEPCSSPHLMATSLKDQTSEETQVSKDVE
EPCSSSQLLMASDQDDSEDETASTSSDLQHPYDSSSESTEDLDDQEVQGSPVIPPDQSDS
TDLPVMTVDGKVDFLVNYMLYKYQVKEVMSMNDIMTLIVREDEDRFHEILMRASERMEMV
FGLDVKEVDPINHCYALFIKLGLTYDGMRNDEYSFPKTGLLILILGVVFMKGNRATEEEI
WEVLNPMGIYAGMTHFMFGDPRELITDEFVREQYLEYQPIANSDPIQYEYVWGLRAKAET
SKMRVLEFVAKVHGSDPTVFLSQYEEALIEEEERTLTMLLEHADSSSTSGESSSDTSSNF
SQV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcttcagaagaatgtgcagctgaccaaggccagacctgtgaagagacccag
aaactacaggttgcagcagcctccatcgatgttgaggagccatgttcctcacctcatctt
atggctactagtctgaaggaccagaccagtgaggagacccaagtctccaaggatgtggag
gaaccatgttcctcttctcaacttcttatggctagcgaccaggatgattctgaagatgag
acagccagtacttccagtgatcttcagcatccctatgactcttcaagcgagtctactgag
gatcttgatgaccaagaagtgcagggtagcccagtcattccaccagatcagtcagatagc
acagatttacctgtgatgactgtagatgggaaagttgatttcttggtgaattacatgctg
tacaagtatcaggtgaaagaggtgatgagtatgaatgatataatgacactcattgtcaga
gaggatgaagatcgttttcatgaaatcctcatgagagcttctgagcgcatggagatggtc
tttgggctggatgtgaaggaagtagatcctatcaaccattgctatgctctctttatcaaa
ttaggtctcacctatgatgggatgcgcaatgatgagtacagctttcctaaaactggtctc
ctgatactcatcctgggtgtagtctttatgaagggcaaccgtgccactgaagaggagatt
tgggaagtattgaatccaatgggaatctatgctgggatgactcatttcatgtttggtgac
cctagagagctgataactgatgagtttgtgagggagcaatacctggaataccagccaata
gccaatagtgatcccatacagtatgaatatgtgtgggggctacgggctaaagctgaaact
agtaagatgagagtgttagagtttgtggccaaggttcatgggtcagaccctactgtgttc
ctttctcagtatgaagaggcactgattgaagaagaagagagaacccttaccatgctatta
gagcatgctgattcaagttctacttctggtgaaagttctagtgacacaagcagcaacttc
tctcaggtctag

DBGET integrated database retrieval system