KEGG   Mus musculus (house mouse): 71970
Entry
71970             CDS       T01002                                 
Symbol
Chchd2l, 2410018M08Rik, Scand3, Zbed5
Name
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 2-like
  KO
K24642  zinc finger BED domain-containing protein 5/7/8/9
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    71970 (Chchd2l)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  Other zinc finger domain-containing proteins
   71970 (Chchd2l)
SSDB
Motif
Pfam: DUF4371 CHCH Dimer_Tnp_hAT DUF2076 zf-C2H2_12
Other DBs
NCBI-GeneID: 71970
NCBI-ProteinID: NP_001346337
MGI: 1919220
Ensembl: ENSMUSG00000034173
Position
5:129924564..129937350
AA seq 735 aa
MRAAPRRAPAAQPPAAAAPSAVGSPAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAIT
GGFSGGGSAEPAKPDITYQEPQGAQLQNQQSFGPCSLEIKQFLECAQNQSDVKLCEGFNE
VLRQCRIANVDHPRPVDHGERNVKRRKYNEGFLQYGFTSTITVGIERPQCVICGVVLSAE
SMKPNKLKRHFESKHSSFAGKDTNYFRSKADGLKKARPDTGSKSNKQNVAAVETSYLVAL
RIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQ
VVQEIKSAPLPICSIQLDESTDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDV
FEAVDSFLRQHEISWKSICGVCTDGAPATLGCQSGFQRLVLNESPKAIGAHCMLHLQTLA
MKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKV
LKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTC
LDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSAFFEEHDIEQHKRITVVISVKEHLDML
ASEISWYFPNLPEIPFALARSPFSVKAEDVPETAQEDFTRLTNSDAARADFSTMPVTQFW
VKCLQSYPVLSEMVLRLLLPFPTTYLCETGFSSLLVIKSKYRSRLVVEDDLRCALAKTTP
RISDLVRKKQSQPSH
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgagggctgctccccgaagagcacctgcagctcagcctccagcagcagctgcgccatct
gcagttggctcacctgccgctgcgccccggcagccaggcctgatggcccagatggctacc
accgcggccggtgtggctgtgggctctgcagtgggacacaccctgggtcacgccatcact
gggggcttcagcggaggtggcagtgctgagcccgcaaagcccgacatcacttaccaggag
cctcagggagcccagctgcagaaccagcagtcttttggaccttgctctctagagatcaag
cagtttctggagtgtgctcagaaccagagcgatgtcaagctctgtgagggcttcaacgag
gtgctgcggcagtgcaggattgcaaatgtggaccatcccaggccagtggatcatggagag
aggaacgttaagagaagaaaatataatgagggttttttgcagtatggttttacctcaacc
atcacagtaggaattgagagaccacagtgtgtcatttgtggggtggttctgtcggcggag
tcgatgaaacccaacaaactgaaacgccattttgagagcaagcattccagcttcgccggc
aaggataccaactatttcagaagcaaagctgatggactcaagaaagccagacctgatact
ggcagcaagtccaacaaacagaacgtggcagccgtggaaacttcctatttggtggccctc
agaattgccagagatatgaaaccgcacacctttgcagagcacttactgttcccggtggcc
aaggacagggttcgcgtcatgatcggagacgaatttgttacaaaactgagtgcagtctcc
ttatctaacgacactgtccgaagaagaatacatgacatgtctgctgatattcttgatcag
gtggtccaggaaattaaatctgctccacttccaatatgcagcatccagctcgatgaatcg
acagacgttgcaaactgtttacagttaatggtttacgtgaggtatattaatgatggtgac
tttaaagatgagtttctttgctgcaaacctcttgaaaggacagctactgcccttgatgta
tttgaggcagtcgactcgtttctgagacagcatgagatctcttggaaaagcatctgtgga
gtttgcacagacggtgccccagctacgctgggctgtcaatctgggtttcagcgcctggtc
ctaaatgagtccccaaaagccattggagctcattgtatgcttcatctgcaaacattagca
atgaagacgctgccccaagacttccaggaagtaatgaaaagtgtcctgagttctgtcaat
ttcgtaaaggcgagttctttgaacagtcgactgtttctgcagctctgcagtgatttagat
gagccaagcaaaaccctgctacttcatactgaagggagatggctgtcaagagggaaagtt
ctaaaacgtatctttgagctccgtgacgaactcaaaatgttttttaaccaaaaagcaata
cggcagttcgaagcacttttcagtgataacagtgcattgcagaaggtagcttatttggtc
gatatctttaccattttgaatgagttgaatttatcactgcaaggaccaaattcaacctgc
ctggatctgtctgaaaagatccactcattccaaatgaaacttcaactctggcaaaaaaaa
ttggatgaaaataaattttacatgttgcctaccttatccgccttctttgaggaacatgac
attgaacagcacaaaaggattacagtggtgatttccgtgaaagaacacttggacatgctt
gcaagtgaaatttcctggtactttccaaatctacccgagattccgtttgcactcgccagg
agcccgttctcagtcaaagctgaagatgttcccgagactgcgcaagaagatttcaccaga
cttaccaacagcgacgcggcgagagctgatttctccacaatgccagtcacacagttctgg
gtcaagtgtttgcagtcatacccagttctgtcagagatggtgttgcgcctcctccttcct
tttccaacaacatatctgtgtgaaacagggttctcaagtttgttagttatcaagtctaaa
tacagaagtagacttgtggtggaagatgatcttcgctgtgctcttgcaaagaccaccccg
agaatttctgatctggtgagaaagaagcagtctcaaccttcgcactga

DBGET integrated database retrieval system