KEGG   Mus musculus (mouse): 71970
Entry
71970             CDS       T01002                                 

Gene name
Zbed5, 2410018M08Rik, Scand3
Definition
(RefSeq) zinc finger, BED type containing 5
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4371 Dimer_Tnp_hAT CHCH zf-C2H2_12 DUF2076
Other DBs
NCBI-GeneID: 71970
NCBI-ProteinID: NP_001346337
MGI: 1919220
Ensembl: ENSMUSG00000034173
Vega: OTTMUSG00000024021
Position
5; 5 G1.3
AA seq 735 aa
MRAAPRRAPAAQPPAAAAPSAVGSPAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAIT
GGFSGGGSAEPAKPDITYQEPQGAQLQNQQSFGPCSLEIKQFLECAQNQSDVKLCEGFNE
VLRQCRIANVDHPRPVDHGERNVKRRKYNEGFLQYGFTSTITVGIERPQCVICGVVLSAE
SMKPNKLKRHFESKHSSFAGKDTNYFRSKADGLKKARPDTGSKSNKQNVAAVETSYLVAL
RIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQ
VVQEIKSAPLPICSIQLDESTDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDV
FEAVDSFLRQHEISWKSICGVCTDGAPATLGCQSGFQRLVLNESPKAIGAHCMLHLQTLA
MKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKV
LKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTC
LDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSAFFEEHDIEQHKRITVVISVKEHLDML
ASEISWYFPNLPEIPFALARSPFSVKAEDVPETAQEDFTRLTNSDAARADFSTMPVTQFW
VKCLQSYPVLSEMVLRLLLPFPTTYLCETGFSSLLVIKSKYRSRLVVEDDLRCALAKTTP
RISDLVRKKQSQPSH
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgagggctgctccccgaagagcacctgcagctcagcctccagcagcagctgcgccatct
gcagttggctcacctgccgctgcgccccggcagccaggcctgatggcccagatggctacc
accgcggccggtgtggctgtgggctctgcagtgggacacaccctgggtcacgccatcact
gggggcttcagcggaggtggcagtgctgagcccgcaaagcccgacatcacttaccaggag
cctcagggagcccagctgcagaaccagcagtcttttggaccttgctctctagagatcaag
cagtttctggagtgtgctcagaaccagagcgatgtcaagctctgtgagggcttcaacgag
gtgctgcggcagtgcaggattgcaaatgtggaccatcccaggccagtggatcatggagag
aggaacgttaagagaagaaaatataatgagggttttttgcagtatggttttacctcaacc
atcacagtaggaattgagagaccacagtgtgtcatttgtggggtggttctgtcggcggag
tcgatgaaacccaacaaactgaaacgccattttgagagcaagcattccagcttcgccggc
aaggataccaactatttcagaagcaaagctgatggactcaagaaagccagacctgatact
ggcagcaagtccaacaaacagaacgtggcagccgtggaaacttcctatttggtggccctc
agaattgccagagatatgaaaccgcacacctttgcagagcacttactgttcccggtggcc
aaggacagggttcgcgtcatgatcggagacgaatttgttacaaaactgagtgcagtctcc
ttatctaacgacactgtccgaagaagaatacatgacatgtctgctgatattcttgatcag
gtggtccaggaaattaaatctgctccacttccaatatgcagcatccagctcgatgaatcg
acagacgttgcaaactgtttacagttaatggtttacgtgaggtatattaatgatggtgac
tttaaagatgagtttctttgctgcaaacctcttgaaaggacagctactgcccttgatgta
tttgaggcagtcgactcgtttctgagacagcatgagatctcttggaaaagcatctgtgga
gtttgcacagacggtgccccagctacgctgggctgtcaatctgggtttcagcgcctggtc
ctaaatgagtccccaaaagccattggagctcattgtatgcttcatctgcaaacattagca
atgaagacgctgccccaagacttccaggaagtaatgaaaagtgtcctgagttctgtcaat
ttcgtaaaggcgagttctttgaacagtcgactgtttctgcagctctgcagtgatttagat
gagccaagcaaaaccctgctacttcatactgaagggagatggctgtcaagagggaaagtt
ctaaaacgtatctttgagctccgtgacgaactcaaaatgttttttaaccaaaaagcaata
cggcagttcgaagcacttttcagtgataacagtgcattgcagaaggtagcttatttggtc
gatatctttaccattttgaatgagttgaatttatcactgcaaggaccaaattcaacctgc
ctggatctgtctgaaaagatccactcattccaaatgaaacttcaactctggcaaaaaaaa
ttggatgaaaataaattttacatgttgcctaccttatccgccttctttgaggaacatgac
attgaacagcacaaaaggattacagtggtgatttccgtgaaagaacacttggacatgctt
gcaagtgaaatttcctggtactttccaaatctacccgagattccgtttgcactcgccagg
agcccgttctcagtcaaagctgaagatgttcccgagactgcgcaagaagatttcaccaga
cttaccaacagcgacgcggcgagagctgatttctccacaatgccagtcacacagttctgg
gtcaagtgtttgcagtcatacccagttctgtcagagatggtgttgcgcctcctccttcct
tttccaacaacatatctgtgtgaaacagggttctcaagtttgttagttatcaagtctaaa
tacagaagtagacttgtggtggaagatgatcttcgctgtgctcttgcaaagaccaccccg
agaatttctgatctggtgagaaagaagcagtctcaaccttcgcactga

DBGET integrated database retrieval system