KEGG   Mus musculus (house mouse): 71971
Entry
71971             CDS       T01002                                 
Symbol
Zswim1, 2410003H12Rik, AI850991, BB046916
Name
(RefSeq) zinc finger SWIM-type containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF5909 SWIM MULE
Other DBs
NCBI-GeneID: 71971
NCBI-ProteinID: NP_001385916
MGI: 1919221
Ensembl: ENSMUSG00000017764
Position
2:164664606..164668787
AA seq 455 aa
MALTMLNGLLIKDSSPPMLHQISKTPQLDAFNYQSCFMQDLFAHFPEVLFIHRTYNPRGK
VLYTFLVDGPRVQVEGPLARAVYFAIPTNEDARGLAQMFQVFKKFNPAWERVNTILVDPH
FLLLPTLTMEFPTAEVLLSAFHICKFLQGKFYQLPLEQPVQRLLLSSLQSTMCSATAGNL
RKLYTLLNNCIPSSRLPELHSHWLLNDRIWLAHRWRSRAQSSRYFQSLEIMAHILSQFFG
TTPFEKQGMASVFRYMQQNSSDKASLSLAETPQDSHTPSEASAENPNTEQLVEARIQHSL
NAICTGPAAQLCLGELAVVQKSMHLIGSGSEKMSIQILEDTHTVQPQPPASCSCYFNQAF
HLPCRHILAMLSARQQVLQPDMLPAQWTSGCASSLDSILGSKWSASLDKHLAVTLLTEEV
GRLLQHCSEEEFERRYSTLRELADNWIGPYEQVQL
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggccctcacgatgctgaatggtctactcattaaggactccagcccacctatgctgcac
cagattagcaagactcctcagctagatgccttcaactaccaaagctgcttcatgcaagac
ctctttgctcatttccctgaggtcttatttatccaccggacctataacccaagaggcaag
gtgttgtacaccttcctggtagatggaccccgggtccaggttgagggtcctcttgcccga
gctgtgtactttgccatccctaccaatgaagatgccagaggcctggcccagatgttccag
gtgttcaaaaagtttaacccagcatgggagagagtcaataccatcctggtggacccccac
ttcctcctgctgcccaccctgaccatggagttccccaccgctgaggtcttgctctctgcc
ttccacatctgcaagttcctccagggtaaattctatcagctgccgttggagcagcctgtc
cagaggctgcttctgtcctccctgcagagcacgatgtgctcagccacagctggcaacctg
aggaagctgtacacgctcctgaataactgcatcccctccagcaggctgccggagctccac
tcacactggctgctcaatgaccgcatctggctggcccaccgctggaggagccgcgcccag
agcagccgctacttccagagtctggagatcatggcccacatcctcagccagttttttggc
accaccccatttgagaaacagggtatggcgtctgtgttccgatacatgcagcagaactct
tcggacaaagccagcctcagcctggccgagacaccccaggacagtcacactccttcagag
gccagcgctgaaaaccccaacacagagcagttggtggaagcccgtatccagcactccctc
aacgccatctgcacggggccagccgcccagctttgcctaggcgagcttgcggtcgtccag
aaatccatgcacctcattggctccggctccgagaagatgagcatccagattctggaggac
acgcacaccgtccagccccagccccccgccagctgcagctgctactttaaccaagccttc
cacctgccctgccgccacatcctagccatgctcagtgcccgccagcaggtactccagccc
gacatgctgcccgctcagtggacctcgggctgtgcctccagtctagacagtatcctaggc
agcaagtggagtgccagcctggataagcacctggctgtgactctgctcactgaagaggtg
ggtcggctcttacagcactgcagcgaggaggagttcgagcgtcgctacagcaccctccgg
gaactggccgacaactggatcggcccttatgagcaggtacagctctaa

DBGET integrated database retrieval system