KEGG   Mus musculus (mouse): 71972
Entry
71972             CDS       T01002                                 

Gene name
Dnmbp, 2410003L07Rik, 2410003M15Rik, TUBA
Definition
(RefSeq) dynamin binding protein
  KO
K20705  dynamin-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    71972 (Dnmbp)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    71972 (Dnmbp)
SSDB
Motif
Pfam: SH3_9 SH3_1 BAR SH3_2 RhoGEF BAR_3 SH3_3
Other DBs
NCBI-GeneID: 71972
NCBI-ProteinID: NP_082305
MGI: 1917352
Ensembl: ENSMUSG00000025195
Vega: OTTMUSG00000061972
UniProt: Q6TXD4 A0A0R4J055 Q9CWU8
Position
19; 19 C3
AA seq 1580 aa
MEPGSMVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLFVCICEFVSRELNSLSLHRGDLVILDDSAPTAGWLQGRSCWGAWGFFPSS
CVQELCLSSRSRRWHAQSALLQAPEYSLGQARALMGLSAQLDEELDFREGDLITIIGVPE
PGWFEGELEGRRGIFPEGFVELLGPLRTVDESVNSRSGDDSAVNGEVDVPPEEAESGGDE
DDQQSGTYGIALYRFQALETNELDFEVGDRIQILGTLEDGWLEGCLKGKTGVFPHRFVKL
CPSNRTEETTAQPQESSFPKDSESSVGKSGDSVVEEARQEPWECEEERPDYDLPGQASVP
QDHVAPEWTGDTISGQDKDASGSSPDVDLERPLAKDLSTPDPSEEVNGVSSQPQVPIHPK
VQKSQHYLTAGGSHQTSDPFSELVPLEARTRDYSSLPPRRTYAQGWSFQKPASHLQRASS
LTASRLDRPSHFCHPAMASYAQKHQTSTENTASLHDPPERPERRPGLQDRGPATDITTAS
QGDSLDLDSKLTQQLIEFEKSLSGPSTEPETIVRRFSIMDFYSEKDIVRGSSNSLPSQAF
PERRKTLRPPPPRPRTPTPISSHLLVDQSPKPVPTLVVRPSRPAPLPPPAQQRMNTASPK
PTSCAHPGWEAPEKEDSEHMEKSPAQTFPCPSMLARIRDVEQDLDTCTRAQEELNLLLEE
KQDDPSRAETLETLRSYESTIQSLTLELQQLRDMTLLSSQSSSLAAPFGSVSTENPEQRM
LEKRAKVVAELLQTERDYIRDLEMCIERVMVPLQQAQVPNVDFEGLFGNMQTVIKVSKQL
LAALEISDAVGMSSCDCLVPGPVFLDHRDELEGTYRVYCQNHDEAISLLEMYEKDEKTQK
HLQDYLADLKGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAV
KEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQ
LKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAMSIWDLCMERGHHDL
EQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTER
AEKLKDKKTLEELQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQQA
LEQLQPLLSLLKATDREGNLIAIFLEEHSRVLQQLQVFTFFPESLPAPRKPFERKTTDRQ
SSRKTLLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKK
KDPMGSQNRWLVDNGVTKGFVYSSFLKPYNPRCSHSDASVASHSSTESEHSGSSPGCHRQ
NSHSALTFNSNNMTVSFTSGLALTQPQDASPLKDCAHETLAVSWNTGHPETGPSTCSSDP
GFSCQRRLGNPADGARDISQPASTLRGCQRGSPHSEVVGYSVPGQNDQGSDSIKGSARVC
QAPEDRDRGVGSSETEGNQVYFAIYTFKARNPNELSVLANQRLRIHEFKDVTGNTEWWLA
EVNGRKGYVPSNYIRKTEYT
NT seq 4743 nt   +upstreamnt  +downstreamnt
atggagcctggatccatggtccgagccatctttgacttctgccctagcgtctcagaggaa
ctgccactcttcgtgggggacgttattgaggtgctggccgtggtggatgaattttggctc
ctagggaagaaggaagatgttacaggacagttccccagcagttttgtggagatcgtgaca
attcccagtctgaaagagggcgagaggctgtttgtctgcatctgcgaattcgtatctcga
gagctgaacagtctttccctccatcggggagacctggtgattctcgacgacagcgctccc
actgcaggatggctgcagggccgaagctgctggggcgcttggggcttcttcccatcctcc
tgtgtccaggagctctgcctctcctctcggagccgacgctggcacgcacagagtgcgttg
cttcaggccccagagtactccctgggacaagcacgggccctcatgggcctttctgcccag
ttggacgaggagttggatttcagggaaggagacctgatcaccattatcggggttcctgag
ccgggctggtttgagggagagttagagggtcggaggggcattttcccagaaggttttgta
gagctgctggggcccctaaggactgtggatgagtccgtaaactccagaagtggagatgac
tccgctgtcaacggtgaggtggatgtccctccagaagaagcagagagtggaggcgacgag
gacgaccagcagtcggggacctatggaatcgccctctacagattccaagccctggagacg
aatgagttggactttgaggtaggggacagaattcaaatactggggaccttggaggatggc
tggctggaaggatgtctgaagggcaagacaggggtctttccccatcgctttgtgaagtta
tgtcctagcaacaggacagaggaaaccacggctcagccccaggaaagcagtttccccaag
gactctgaaagctctgtgggcaagtcaggggactccgtggtggaggaagcaagacaggaa
ccatgggagtgtgaagaagaaagacctgactatgatctcccaggacaagcctccgtgccc
caagatcacgtagcacccgagtggactggagatacgatctcaggtcaggataaagatgct
tcagggagctctcctgatgtggatcttgaaaggcctcttgctaaagacctttccacacct
gacccctcagaggaagtcaacggtgtttcttcccagcctcaggtacctattcatcccaaa
gtgcagaagagccaacactatctaacagcaggagggagccaccaaacctctgacccattc
tctgagcttgtcccactagaagccaggaccagagactactccagcctgcctcctagaaga
acatacgcccaaggttggtcattccagaagccagcgtcccacctccagagggcctcttcc
cttacagcctcaaggctagacagacccagccacttttgccatccagccatggccagctat
gctcagaagcaccaaacatctacagaaaatactgccagcctccacgatccaccagagaga
ccagagagaaggcctggcttacaagacagggggcctgccacagatataaccacagcgtca
cagggggacagcctggacctagattccaagttgacccaacagctgatagagtttgagaag
agtctgtcagggcccagcacagagccagagacgattgtacgccgcttttcaatcatggac
ttttactctgagaaggatatcgtgagaggctcctcaaattcactaccctcacaggctttc
cccgagaggagaaagaccctgaggccaccacctcctagaccccgtaccccaacacccatt
tcctcccacttgctagttgaccagagcccgaaacctgtacccaccttggttgtgcggccc
tcccgaccagctcctctgcctcctcctgcccagcagaggatgaatacggcctcccccaag
cccacctcctgtgcccatcctggctgggaggccccagagaaggaggactctgagcacatg
gagaagagcccagcccagacttttccgtgcccctccatgctggcaaggatccgggacgtg
gaacaggacctggacacgtgtaccagggctcaggaagagctgaacttgctgttggaggaa
aagcaagatgacccgtcgagggcagagactcttgagactctcagatcctacgagagcacc
attcagagcctgaccctggagcttcagcagctgagagacatgacgctcctctcttcccag
tcttcatccctggcggccccctttgggtctgtgtccactgaaaacccagagcagaggatg
ctggagaagagagccaaggtggtggcggagcttttgcagacggagagagactacatccgg
gatctggagatgtgcattgagagggtcatggtgcccctgcagcaggcacaggtaccaaac
gttgattttgaaggactttttggaaatatgcaaacagtgattaaagtctcaaagcaattg
ttggcggccttggaaatcagcgatgctgtaggtatgagctcatgcgattgtttggtccca
ggacccgtgtttcttgaccaccgagacgagcttgagggaacgtacagggtttactgccag
aaccacgatgaagccatctccctgctggaaatgtatgagaaggacgagaagacccagaag
caccttcaggactacctggcagatctcaagggatgcaccaattacatcaacctgggctcc
ttcctcatcaagcccgtacagagaataatgcgttacccgctgctgctgatggagttgctg
aattccaccccagaatcccacccggataaagtgcctttaaccaacgcggtcctcgccgtc
aaggagatcaatgttaacattaatgagtacaagcgtcggaaggatctggtgcttaagtac
cgcaaaggggatgaagatagcctgatggaaaagatctccaagctgaacatacactccatc
atcaagaagtccagccgcgttagcagccacctcaaacacctcactggcttcgctccgcag
ctaaaagatgaagtatttgaagagacagaaaagaacttccggatgcaggagagattgatt
aaatcttttatccgagacctgtccctctacctccagcatatacgggaatctgcatgtgtg
aaggtggtggcagccatgagcatatgggatctgtgcatggagaggggacatcatgacctg
gagcagttcgagaaggtgcatcgctacatcagtgaccagctcttcacacggtttaaagag
aggaccgagcggctcgtcatcaatcccttaaaccagttgttgaacatgttcacggggccc
tacaagctggtgcagaagcggttcgacaagctcctggacttctacaactgcactgagcga
gcggagaagctgaaggacaagaagactctggaggagctgcagtcagcccgaaacaactac
gaggccctgaactcgcagctgctggacgagctgcccaagttccagcagtacgcccagagc
ctcttcaccaactgcatccacggctatgccgaagcccactgtgacttcgtgcagcaagcc
ctggagcagctgcagccgctgctgtcgttactgaaagccaccgaccgagaaggcaacttg
atcgccatcttccttgaggagcacagccgggtgctacagcagctccaggtcttcacattc
ttccccgagtccctcccagcgcccaggaagccctttgagaggaaaaccacagaccgccag
tcatcccggaagacccttctgggcatgccaagctacatgctgcagtcggaagagctgcgg
agctccctgctggcgaggtacccgccggaaaagctcttccacgtccagcggaacttcaac
gctgcgcaggacttggatgtctcccttttggaaggcgacctggtgggcgtgatcaaaaag
aaagaccccatgggcagccagaaccgctggctcgtggacaacggagtcaccaaaggcttt
gtctacagctccttcctgaagccttacaatcctcgctgcagccattcggatgcctccgtg
gccagccactcctccacggagtcagagcacagtggctcctcccccgggtgccatcgacag
aacagccacagtgccttgaccttcaactccaacaacatgactgtgtccttcacctcagga
cttgccctaacgcagcctcaggatgcatctccactgaaggactgtgcccacgaaactctc
gctgtgtcctggaacacagggcatccagagactggaccttccacgtgctcttccgaccca
ggcttttcctgccagcgcaggctggggaaccctgcagatggtgccagagacatcagccaa
cctgcttcaaccttgaggggctgccagcgaggctccccgcattcagaagtggtcggttac
tctgtgccagggcaaaatgaccaaggcagtgactctataaaaggctctgcaagagtctgt
caggctccagaagacagagacagaggggtcgggagcagcgagacagagggcaaccaggtc
tattttgccatttatactttcaaggcacgaaacccaaatgaactgagtgtgttagccaat
cagagactcaggatccatgagtttaaagacgtcacaggcaatacagagtggtggttggct
gaagttaacggaaggaagggctacgtcccatccaactatatccggaaaaccgagtacacc
tga

DBGET integrated database retrieval system