KEGG   Mus musculus (house mouse): 71985
Entry
71985             CDS       T01002                                 
Symbol
Acad10, 2410021P16Rik
Name
(RefSeq) acyl-Coenzyme A dehydrogenase family, member 10
  KO
K11729  acyl-CoA dehydrogenase family member 10
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99983 Lipid metabolism
    71985 (Acad10)
SSDB
Motif
Pfam: APH Acyl-CoA_dh_1 Acyl-CoA_dh_M Hydrolase Acyl-CoA_dh_2 Acyl-CoA_dh_N HAD_2 EcKL RIO1 Hydrolase_like Kdo Hydrolase_6 DUF1679
Other DBs
NCBI-GeneID: 71985
NCBI-ProteinID: NP_082313
MGI: 1919235
Ensembl: ENSMUSG00000029456
UniProt: Q8K370
Position
5:complement(121759089..121798642)
AA seq 1069 aa
MLVRRLFQPSTLHWAWRTTALNHPLGRHQGGLRWTHSGGRSYRAVIFDTGGVLVPSPGTV
AVGWEVQNHVPSGTIVKAFIRGGDSGPWIRFIKGEITTEHFLEEFGRLCSEIAKTSVPVS
SYFSLLTSEQVTKQFPVMTQAISQIRAKGLQTAVLTNNFHLSSGESFLPLDRKQFDVVVE
SCLEGICKPDPRIFQLCLQRLSLQPSEAIFLDDLGSNLKVAASLGIHTIKVDRPETAVKE
LEALLGFPLHLGVPNTRPVRKTMAIPQDALEKYLKGLLGTHSTGPMELLQFDHGQSNPTY
YIRLADRQLVLRKKPSGTLLPSAHAIEREFRIMKALANAGVPVPTVLDLCEDSSIIGTPF
YLMEYCPGIIYKDPSLPGLEPSRREAIYTAMNQVLCRIHSVDLQATSLDSFGKQGDYIPR
QVQTWTKQYRAAETSSIPAMERLIQWLPLHLPRQQRTTLVHGDFRLDNLIFHPEKAEVLA
VLDWELSTLGDPFADVAYSCLAYYLPSSFPILRGFRDQDVTKLGIPTVEEYFRMYCLNMG
IPPIDNWNFYMAFSFFRVAAILQGVYKRSLTGQASSATAQQSGKLTESMAELAWDFATKE
GFRVFKEMPATKTLSRSYHAWAGPRSPRTPKGVRGHSTVAAASPSHEAKGGLVISPEGLS
PAVRKLYEQLVQFIEQKVYPLEPELQRHQASADRWSPSPLIEDLKEKAKAEGLWNLFLPL
ETDPEKKYGAGLTNVEYAHLCEVMGMSLYASEIFNCSAPDTGNMEILVRYGTEEQKARWL
VPLLEGRIRSCFAMTEPQVASSDASNIEASIKEEDGCYVINGHKWWTSGILDPRCKLCVF
MGKTDPQAPRHQQQSMLLVPMDSPGITVIRPLSVFGLEDPPGGHGEVRFKDVRVPKENIL
LGPGRGFEIAQGRLGPGRIHHCMRLIGYSERALALMKTRVMSRTAFGKPLVEQGTILADI
ARSRVEIEQARLLVLKAAHLMDVAGNKTAALDIAMIKMVVPSMAYHVIDRAIQAFGAAGL
SSDYPLAQFFGWARALRFADGPDEVHQLTVAKMELKNQSRMQEPAVPRV
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgttggtaagaagacttttccagccttccactctgcactgggcatggaggaccacggcc
ctgaaccatcccctgggcaggcatcagggaggcctccgctggacacattctggaggccga
agctacagagcagtcatttttgacacgggcggagttctcgtgccttctccagggacagtg
gctgtgggctgggaggtgcagaatcatgtcccttctggaactatagtgaaggctttcatc
agaggtggcgacagtgggccctggataaggtttataaaaggagagataacgaccgagcac
ttcttggaagaattcgggagactgtgctctgaaatcgcaaagacttccgtgcccgtgagc
tcctatttctctctgctgaccagtgagcaggtgacaaagcagttcccggtgatgactcag
gccatctctcagatcagagcaaaaggcctccagactgcagtcctcaccaacaactttcat
ctttccagcggggaaagcttcctgcccctggaccggaaacagtttgatgtggtggttgag
tcctgcctggaaggcatctgtaagccagatcccaggatattccagctgtgcctgcagagg
ctgagcctgcagccctcagaggctatttttcttgatgatctgggatccaatctaaaagtg
gctgccagcctgggcattcacaccatcaaggttgacaggcccgagacagcagtgaaggag
ctggaggctctactgggtttcccactgcacttgggcgttcccaacacccggcctgtgagg
aagaccatggcgattccacaagatgccttggagaagtacctgaagggcttgctggggacc
cactccaccggccccatggagctccttcagtttgatcatggacagtcaaacccaacgtac
tacatcaggctggctgaccgtcagctggtcctgaggaagaaaccctcggggaccctcctc
ccctctgcccatgccatagaaagggaattcaggatcatgaaagcccttgcaaatgcagga
gtccctgtccctactgttcttgacctctgtgaagactcaagcatcatcggcacccccttc
tacttgatggagtactgcccgggcatcatctacaaagacccctccctgcccggcttggag
cccagccggcgggaagccatatacactgccatgaaccaagtcctgtgcagaattcacagt
gtggacctgcaggccaccagcctggacagcttcggcaagcaaggggactatattcctcga
caggtgcaaacctggaccaagcagtaccgagcagcagaaaccagcagcatcccagcaatg
gagaggcttatccagtggctgccactgcaccttcccaggcaacagagaaccacgctggtg
catggtgacttcaggctggacaacctgatattccatcctgaaaaggcggaagtgctcgct
gtcctggactgggaactttccaccttaggagacccctttgctgatgtggcctacagctgc
ctggcctactacctgccatccagctttcccattctgagagggttcagagaccaggatgtg
acaaagctgggcatccccactgtggaggaatacttcaggatgtactgtcttaacatgggc
atcccacccatcgacaactggaacttctacatggctttctcctttttccgggtggctgca
atcctacagggagtctacaagcggtcactcacaggccaggcaagctcagcaacagcccaa
caaagtggaaagctcactgagtccatggctgagctggcctgggattttgccaccaaagaa
gggttccgggttttcaaagagatgccagccaccaaaacactgagcagatcctaccatgcc
tgggcgggaccgaggtccccgaggactcccaagggtgtgaggggtcacagcactgtagca
gctgcttccccttctcacgaggcaaagggaggcctggtcatctctccagagggcctgtct
cctgcggtcagaaagttgtatgagcagctggtgcagtttatagaacagaaggtgtacccc
ctggagccagagctgcagagacaccaggcctcggccgacaggtggagcccttccccgctg
atagaagacctcaaggagaaagccaaggctgagggactttggaaccttttcctacccttg
gagactgatcctgagaaaaagtacggagcagggctgactaacgtggaatatgcacatctg
tgtgaagtgatgggcatgtctctgtatgcttctgagatatttaattgctctgccccggat
acggggaatatggagatcctggtgcggtatggcactgaggagcagaaggcccgctggctg
gtgccactgttggagggcaggatccgttcttgctttgccatgactgagcctcaggtggcc
tcctcagatgcctctaacatcgaggcttccatcaaagaggaagatggctgctatgtcata
aatggtcacaagtggtggacctcaggcatcctggatcctcgatgcaaactctgtgtgttt
atggggaaaacagacccacaggccccaaggcaccagcaacaatctatgctcttggttccc
atggactcgccaggaatcacagtcatccggcctctgtcagtgtttggtttggaggatcct
ccaggtggccacggtgaagtacggttcaaggacgtgcgtgtgcccaaggaaaacatactc
ctgggccctggccgaggctttgagatcgctcagggcaggctggggcctggccggattcat
cactgcatgaggttgattgggtattcagagagggccctggcactcatgaagacacgggtg
atgtcccgcacggccttcgggaagccccttgtggagcagggcaccatcctggcagacatt
gcccggtcacgtgtggagatcgagcaggcccggctgctggtgctgaaagctgctcacctc
atggatgtggccggaaataagactgcagctttagacattgcaatgattaaaatggtcgtc
ccttccatggcctatcacgtaattgaccgcgctattcaggcctttggagcagcgggcctc
agcagtgactaccccctggctcagttctttggctgggcccgagccctgcgcttcgctgat
ggccctgatgaagtacaccagctgacagtggctaagatggaactgaagaatcagtccagg
atgcaggaaccagcagtgcccagagtgtag

DBGET integrated database retrieval system