KEGG   Mus musculus (house mouse): 71994
Entry
71994             CDS       T01002                                 
Symbol
Cnn3, 1600014M03Rik, C85854, Calpo3
Name
(RefSeq) calponin 3, acidic
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Calponin CH CDC24 CAMSAP_CH
Other DBs
NCBI-GeneID: 71994
NCBI-ProteinID: NP_082320
MGI: 1919244
Ensembl: ENSMUSG00000053931
UniProt: Q9DAW9
Position
3:121220190..121251854
AA seq 330 aa
MTHFNKGPSYGLSAEVKNKIASKYDQQAEEDLRNWIEEVTGLGIGTNFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYPDDYPREYQYGDDQGIDY
NT seq 993 nt   +upstreamnt  +downstreamnt
atgacccacttcaacaagggcccttcctacgggctctccgccgaagttaagaacaagatt
gcatccaagtatgaccagcaggccgaggaagatctgcgcaactggatagaagaggtgaca
ggcctaggcattggcaccaacttccagctggggctgaaggacggcatcatattgtgcgaa
ctcataaacaagctacagccaggctctgtgaagaaagtcaacgaatcctcactaaattgg
ccccagttggagaatatcggcaacttcattaaagctatccaggcttacggtatgaagccc
catgatatatttgaagcaaacgacctctttgagaatggcaacatgacccaggttcagacg
acgctggtggctctagcaggtctggcgaaaacaaaaggattccatacaaccattgacatt
ggcgttaagtatgcagaaaaacaaacaagacgttttgatgaaggcaaattaaaggctggc
cagagtgtaattggtttacagatgggtaccaacaaatgtgccagccaggcgggcatgaca
gcctatgggactcggaggcatctttatgatcccaagatgcagacggacaaaccctttgac
cagaccacgattagcctgcagatgggcaccaacaaaggggccagccaggctgggatgtta
gcaccgggcaccagaagagacatctatgaccagaagctgacattacagccagtggacaac
tcgaccatttctctacagatgggcaccaacaaagttgcttcccagaaaggaatgagcgtg
tatgggcttgggcggcaagtatatgaccccaagtactgtgccgcacccacagaacctgtc
attcacaacggaagccagggcacgggcaccaatgggtcggaaatcagtgatagcgattat
caggcagaataccccgatgaatatcatggcgagtacccagacgactaccctcgggagtac
cagtatggcgacgaccagggcattgattattag

DBGET integrated database retrieval system