KEGG   Mus musculus (mouse): 72003Help
Entry
72003             CDS       T01002                                 

Gene name
Synpr, 1500003F20Rik, SPO
Definition
(RefSeq) synaptoporin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL DUF588 Frizzled ECF_trnsprt PGG DUF3278 DUF1129
Motif
Other DBs
NCBI-GeneID: 72003
NCBI-ProteinID: NP_001156504
MGI: 1919253
Ensembl: ENSMUSG00000056296
Vega: OTTMUSG00000027769
UniProt: Q8BGN8
Position
14; 14 A1
AA seq 265 aa AA seqDB search
MCMVIFAPLFAMFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLQQVTFEVPT
CEGKEQQKLALVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV
TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAVHSPVMSSLNTSV
VFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGRYNQESYGSSGGYSQ
QANLGPTSDEFGQQPSGPTSFNNQI
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatggtgatatttgctccgctttttgcaatgtttgcatttgcaacatgtggtggc
tattcaggaggcctgcggctgagtgtggactgtgtcaataagacagaaagtaacctcagc
attgacatagcgtttgcgtacccattcaggctgcaacaggtgacctttgaagtgcccacc
tgtgagggaaaggaacagcagaagctggcattggttggagactcctcatcctcagcagaa
ttctttgtcaccgtggctgtgttcgcctttctctactccctggctgccacggtcgtgtac
attttcttccagaacaagtaccgcgaaaacaaccggggcccactcattgactttatcgtc
actgtagtcttttcattcttgtggctggtgggttcctctgcttgggcaaaaggactgtct
gatgtcaaagtggcaacagatcccaaagaagtcctgttgctgatgtcagcttgcaagcag
ccttccaacaagtgcatggctgtccacagccctgtcatgtccagcttaaacacatctgtg
gtcttcgggtttttgaattttatcctctgggctggaaacatttggtttgttttcaaggag
actggctggcattcctctggacagagatacctttcagaccccatggagaagcactccagc
agctacaatcaaggacgctacaaccaagagagttatgggtcaagtggtgggtacagccag
caggcgaatctggggccaacttccgatgagtttggccaacagcctagtggtcccacttcc
tttaacaatcagatataa

DBGET integrated database retrieval system