KEGG   Mus musculus (mouse): 72016
Entry
72016             CDS       T01002                                 

Gene name
Tedc2, 1600002H07Rik
Definition
(RefSeq) tubulin epsilon and delta complex 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4693
Other DBs
NCBI-GeneID: 72016
NCBI-ProteinID: NP_082332
MGI: 1919266
Ensembl: ENSMUSG00000024118
Vega: OTTMUSG00000032971
UniProt: Q6GQV0
Position
17; 17 A3.3
AA seq 436 aa
MLGVKGNYLLPADCAHRLVAELQGALDSCADRQRQLERSLRVSRRLLQVWEPARTPSPVP
ETKEEDPSPACAPSSQDLEELELLTQALEKAVRVRKGVSNAGQRDRTPTLTSKAATSGAA
AASHPRAPSRGGSRVLGTRSTKGIQRATAPPKDYPEHRLRSKGDKTHVRTQDQTTGYGPD
LRDQQMTPSSAHHTTELFALKEKGTLLQLPEDFRKAVSRNSCLWAQLNSARTNDSTDATR
AAKTQFLHKLQMASGCSSHRPSATEVEAHARILRKACMLLRLRMQKELAIAPTDWMQEYR
CLLTLEGLQTVVGQCLHRIQVLQAAVTEQLPGECLAETRTQASSVCGGEVDSACSPELLL
YASTEELQTLATLKLQVALLHQQIHLEKVLMAELLPLINTQDPGGPPWLALCRAAYSLLC
EGGERFLTVLRDDPAD
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgcttggtgttaaaggaaactacctactacccgcagactgcgctcaccggctggtagcg
gagctgcagggcgccttggactcctgcgccgatcggcagcggcagttggagcggagcctg
cgcgtttccaggaggctgctgcaggtctgggaaccagccaggaccccatctccagttcca
gaaaccaaagaagaggacccaagtccagcatgtgcaccgagttctcaagatctcgaggag
ctggaacttttgacccaggctctggagaaggctgtacgtgtgaggaaaggcgtgtccaat
gctggacaaagagacagaacccccactctgacatctaaggcagccacttctggtgccgct
gccgcctcccatcctcgggctcccagccggggtggcagccgtgtattgggtacaagatcc
accaagggtatacagcgggccacagcccctcccaaggattaccctgagcacagactacga
tcaaagggtgataagacccatgtaagaacacaagaccaaactactgggtatggaccagac
ctcagggaccaacaaatgaccccgtcatctgctcatcacaccacagaactcttcgcatta
aaggagaaggggactctcctgcagctacctgaggacttcaggaaggcagtgtctcggaat
tcctgcctgtgggcccagctcaactctgcacgaaccaacgactccacagatgccactaga
gccgccaaaactcagttcctccacaaactccagatggcttcaggctgttccagccacagg
cccagtgctacagaggtggaggcgcacgcacggatcctgaggaaggcctgtatgctgctg
agacttcgtatgcaaaaggaacttgcaatagctcccactgactggatgcaggagtaccga
tgcctgctcaccctggaaggactgcagaccgttgtaggacagtgtctccacaggatacag
gtgctgcaagcagctgtgacagagcaacttccaggagaatgccttgcagagacgcgcact
caggcctcgtccgtttgcggaggagaggtggactctgcctgcagccctgagctccttctc
tatgctagcaccgaggagctgcagaccttggccaccttgaagcttcaggtggccttgcta
caccagcagatccatctagaaaaggttctgatggctgaactcctccctctgataaacacc
caggatcctggaggaccgccttggctggccttgtgtcgggctgcgtacagtctgctctgt
gagggaggcgaacgcttcctcacagtccttcgagatgaccctgctgactaa

DBGET integrated database retrieval system