KEGG   Mus musculus (house mouse): 72023
Entry
72023             CDS       T01002                                 
Symbol
Cyb561d1, 1600010M23Rik
Name
(RefSeq) cytochrome b-561 domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Cytochrom_B561 DUF6249 DUF5325
Other DBs
NCBI-GeneID: 72023
NCBI-ProteinID: NP_001074789
MGI: 1919273
Ensembl: ENSMUSG00000048796
UniProt: A2AE42 Q6PAS2
Position
3:complement(108103082..108109542)
AA seq 229 aa
MHSMEVGLVPAPAREPRLTRWLRRGSGILAHLIALGFTIFLTVLSRPGTSLFSWHPVFMA
LAFCLCMAEAILLFSPEHSLFFFCSRKTRIRLHWAGQTMAILCAVLGLGFIISSKIRSEM
SHLVSWHSWIGALTLLATGGQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVT
VLLGMYSVWFQAQIKGTAWYLCLGLPLYPALVIMHQISSSYLPRKKVEI
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcattccatggaggtaggtctggttcccgctccagcgagggagccgagactgacccgc
tggctgcggagaggcagtgggatcttggcgcacctgatagctttgggcttcaccatcttt
ctgactgtgctgtcccggcccggaaccagtcttttctcctggcaccctgtgttcatggcc
ttggcgttctgtctctgcatggctgaagctattctactcttctcacctgagcactccctg
ttcttcttctgctctcgaaaaacccggattcgactccactgggcagggcagaccatggcc
atcctctgtgctgtcctaggcttgggcttcatcatttccagcaagatccgaagtgagatg
tcccatttggtgtcctggcacagctggataggagccttgacactgttggccactggagga
caggcactgtgtgggctctgcctcctctgtccacgagcagcccgggtctcaagggtggct
cgcctcaagctctaccatctgacgtgtggcctggttgtctacctgatggctacagtaacg
gtgctcttgggcatgtactcagtgtggttccaggcccagatcaaaggtacagcctggtac
ctgtgcctgggactaccattgtacccagccctggtgatcatgcaccagatctccagctcc
tacttgccaaggaagaaggtggagatatga

DBGET integrated database retrieval system