KEGG   Mus musculus (mouse): 72027
Entry
72027             CDS       T01002                                 

Symbol
Slc39a4, 1600025H15Rik, AU041686, AWMS2, ZIP4
Name
(RefSeq) solute carrier family 39 (zinc transporter), member 4
  KO
K14710  solute carrier family 39 (zinc transporter), member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04978  Mineral absorption
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    72027 (Slc39a4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    72027 (Slc39a4)
   05012 Parkinson disease
    72027 (Slc39a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    72027 (Slc39a4)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   72027 (Slc39a4)
SSDB
Motif
Pfam: Zip ZIP4_domain
Other DBs
NCBI-GeneID: 72027
NCBI-ProteinID: NP_082340
MGI: 1919277
Ensembl: ENSMUSG00000063354
UniProt: Q78IQ7
Position
15:complement(76496583..76501579)
AA seq 660 aa
MLPKSVTQGLVLALLVGTVAVARPRNLLSLLALGQGALDRLELDGLLNTLVARVHCTDGP
CEKCLSVENVLALGKPDKPQPAPESVLESRHIIYLSAAAALYLNNPEKTCKDIQAGLLAS
HVDDYLATLESPEAMTLGLSQLLQKIEAHAASQPTGEKTCVDLPQLLEEAEAAGVSKSAG
LVLTALLDHVINGSCFQGLPSPQYFVDFVFRLHSSDPPNITLHELENLMHHLGVGGEDHS
DHDDHGDHADHSHPDRKASHQDSELHTPHNSNSSVWDTLCLSAKDIMAVYGLSEEAGVSP
QAWAQLTPALVQQQLSGACSPYPTIRIQDQLSQTERYLYGSLATLLICLCAVFGLLLLTC
AKCSTATHYIMQTFLSLAVGALTGDALLHLIPKVLGLHTHGGEGHTHEEEVGVGGQATWR
LLAVLGGFYIFFLFESFFNLLLPRDQDSEKDGPCSHGGHSHGISLQLAPSNLRQSKQTHE
SSRSDLVAEETPELLNPETRRLRAELRLLPYLITLGDAVHNFADGLAVGAAFSSSWKTGL
ATSLAVFCHELPHELGDFAALLHAGLSVKRALLLNLASALTAFAGLYVALAVGVGEEGEA
WILAVATGLFLYVALCDMLPAMMNVRDQRPWLLFLLHNVGLLGGWTVLLLLSLYEDNITF
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgctcccaaagtcggtcacacagggacttgtgttggctctgctggtgggcacagtggca
gtggcccggcccaggaacctgctcagcctgctcgccttgggccagggtgctctggatcgc
ctggaactggacggcctgttaaatacgctggtggcccgtgtgcactgcaccgacgggccg
tgtgaaaagtgtctgtctgtggagaatgtcttggctctaggcaaacctgacaagccacag
cctgccccagaatcagtcctggagtccagacacattatttaccttagtgctgctgctgcc
ctctaccttaacaacccagagaaaacatgcaaggacatccaagctggcctcttggcctcc
catgtggacgattacctggccacactggagagtccagaggccatgaccctgggtctgagc
cagctactgcagaagattgaggcccatgctgccagccaacccaccggggagaagacctgt
gtagatcttccccaactgctggaggaggctgaggcagcaggggtttccaaaagcgccggc
ctggtcttgactgccttgctggatcatgtcattaatgggtcctgcttccaaggcctgcct
agccctcagtactttgtggactttgtgttcaggctacacagtagtgaccctcccaatatc
acgctgcatgaactggagaatttgatgcatcaccttggggtgggtggagaggaccacagt
gaccatgatgaccacggtgatcatgctgaccacagtcatccggacaggaaagccagccac
caagactctgagctccatactccccacaacagcaactctagtgtatgggacacgctgtgc
ctgagtgccaaagatataatggctgtgtatgggctatctgaagaggctggggtgagccct
caggcctgggcccaactgacccctgccttggtccagcagcagctaagtggagcctgcagc
ccctaccccactatccgtattcaggaccagctcagtcaaacagagaggtatctctatggc
tcgctggccaccctgctcatctgcctctgtgctgtgttcggtcttctgctgctgacctgt
gccaaatgcagcacagccacccactacatcatgcagaccttcctaagcttggctgtgggc
gcacttaccggcgatgctcttctgcacctgatacccaaggtgctgggactgcacacacat
ggtggagagggtcacacccatgaggaggaggtgggcgttggtgggcaggccacctggcgc
ctgctggctgtacttggaggcttctacatcttcttcctgtttgagagcttcttcaacctc
ttgttgcccagggaccaggattctgagaaagatgggccttgtagccatggtgggcacagc
catggaatatctctgcagctggcaccaagcaatctccgacagtccaaacagacccatgaa
agctctcgttcagacttggtggcagaggagaccccggaactactgaacccagagacccgg
cgactgagagcagagctgagactgttgccctatctgatcacactgggcgacgcggtacac
aacttcgctgacgggctcgctgtgggcgccgccttctcatcctcgtggaagactgggctg
gccacttcattggcggtgttctgtcatgagctgccccatgaactcggggacttcgctgct
ctgctgcatgccgggctgagtgtgaagcgtgcgcttttgctgaatctggcctcagcgctc
acagcattcgcaggcctctacgtggctctagcagtcggagtaggcgaggagggcgaggct
tggattctggcggtagcaaccggcctcttcctttacgtggcgctttgtgacatgctccca
gccatgatgaatgtgcgcgaccagcggccctggcttcttttcctgctccacaacgtgggt
ctgctgggcggctggaccgtcctgctgctgctgtcattgtacgaagacaacatcaccttc
tga

DBGET integrated database retrieval system