KEGG   Mus musculus (mouse): 72033
Entry
72033             CDS       T01002                                 

Gene name
Tsc22d2, 1810043J12Rik, 5530402M19Rik
Definition
(RefSeq) TSC22 domain family, member 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TSC22 YabA K-box DivIC ZapB
Other DBs
NCBI-GeneID: 72033
NCBI-ProteinID: NP_001074698
MGI: 1919283
Ensembl: ENSMUSG00000027806
Vega: OTTMUSG00000052593
UniProt: E9Q7M2
Position
3; 3 D
AA seq 769 aa
MSKMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE
EVCERSSSEETLNNVGDAETPGTVSPNLILDGQLAAASAAPANGGGGGVSARSVAGALAQ
TLAAAAASVSTPGPSSATPSQPPATCSSRFRVIKLDHGSGEPYRRGRWTCMEYYERDSDS
SVLTRSGDCIRHSNTLEQTAERDSGLGATGGSVVVVVASMQGAHGLDSGTDSSLTAVSQL
PPSEKMSQPTLAQPQSFSVGQPQPPPPVGGAVAPSSASLPPFPGAATGPQPMTAAVQPTQ
LQGAVAGGALPGPVGQGLPPPPNVNLAQPVALAAQPGPAGGSSLSQQFAYPQPQIPPGHL
LPMQPSGQSEYLPPHVALQPPSPAQPLSTSASATSASAASFPLGSGQSVSSLGAQMMGAS
AQPSEAVAPGPVPVGQAAPCQPAGVAPAALGGVVQPGSGLTGVGQPQPVQPPQQMGGSGQ
LPAVPGGPHTVVPGVPNVPAAVPVPSVPSVPTTSVTMPNVPAPLGQSQQLSSHTPVSRSS
SVIQQVGSPLAQGTHSAPTSLPQSDLSQFQTQTQPLVGQVDDTRRKSEPLPQAPLSLIAE
SKPVVKPPVADALTNPLQLTPMNSLATSVFSIAIPVDGDEDRNPSTAFYQAFHLNTCQES
KSLWDSASGGGVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELVERNSLLERENA
LLKSLSNNDQLSQLPAQQANPGSTSQQQAMIAQPPQPTQPPQQPNVSSA
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgtccaagatgccggccaagaagaagagctgcttccagatcaccagtgtcaccacggct
caggtggccaccagcatcaccgaggacaccgagagcctggacgacccggacgagtcgcgc
acggaggacgtgtcctccgagatcttcgacgtttcccgggccacggattacggcccggag
gaggtgtgcgagcgtagctcctcggaagagacgctcaacaatgtcggggatgcggaaact
cccgggaccgtgtccccgaacctcatcctggatgggcagctggcagccgcttcagctgcg
cccgccaacggaggcggcggtggcgtgtcggcccggagcgtggcgggggcactcgcccag
accctggcggcggccgccgcttcggtgtccactcctgggccgagtagtgcaactccatct
cagccccctgccacttgtagttcgcgtttccgcgtgatcaaactagaccacgggagcggg
gagccgtaccggcgcggccgatggacgtgtatggaatactacgagcgggattcggatagc
agcgtcctcaccaggtccggggattgcattagacacagcaatactttggagcagactgcg
gagcgggacagcggcctgggagccaccggagggtcggtggtggtggtggtggcctccatg
cagggggcgcacgggctggactcgggaactgacagctccttgactgctgtgtcacagcta
cccccgtcggagaaaatgagccagcccactctcgcccagccgcagagtttcagcgtcggg
cagccgcagcctccaccgcccgtaggtggggctgtggctccaagttcggcgtcgctgccg
ccgttcccgggagcggcgaccgggccgcagccaatgacagcagccgttcagccaacccag
ctccagggagccgtggccggaggcgccctccccgggcctgtcggtcaggggctgccgccg
ccgccgaatgtcaacctggcgcagcctgtggccctggcagctcagcccggcccggccggc
ggctcctcgttgtcacagcagttcgcctatccccagcctcagataccacccgggcatttg
ttgccgatgcagccatccggccagagtgagtacctgccgccgcacgtggccctgcagccg
ccaagccctgcgcagcccttgtctaccagcgctagcgccacctctgcttccgcggccagc
tttcctctggggtctggccagagcgtctcctccttgggtgcccagatgatgggcgcctcc
gcccagcccagtgaagctgtggccccgggtccggttcctgtaggccaggccgctccttgt
cagccggccggagtggccccagctgctctaggaggcgtggtgcagccaggctccgggctt
actggggttgggcagccccagcccgtgcagcctccgcagcagatgggtggcagtggtcag
ctgccagccgtgcctggtggtcctcacaccgtggtgcccggagttccaaacgtgcctgca
gcggtacccgttccaagcgtgcctagtgtgcccaccacttctgttactatgccaaatgta
cccgcgcctctgggccagtctcagcagctgagcagccatacgccagtcagccggagcagc
agcgtcatccagcaagttggttcacccttagctcaaggcacacacagtgcaccaacaagt
ctaccacagtctgacctaagccagtttcagactcagacccagcctttagtcgggcaagtt
gacgatactagaagaaaatcagaacccctacctcaagcaccactttctctcattgctgaa
agtaagcctgttgtgaagcctccagttgcagatgccctgacaaaccctcttcagttaaca
cctatgaacagtctggccacctctgtattcagcatagctattcctgttgatggtgatgaa
gacaggaatccttcaactgctttctaccaagcgttccatttgaacacgtgtcaggaatca
aagagcctctgggatagtgcatctgggggcggtgttgtagccattgacaacaaaatagaa
caagcaatggatctggtgaaaagccatttgatgtatgcagtaagagaagaagtggaagtt
ctaaaggagcaaataaaagaattagtggaaagaaactctttacttgaacgagaaaatgca
ctgttaaaatctctttcaaacaatgatcagttgtcccaactcccagcccaacaggccaat
cctggtagcacttctcaacaacaagcaatgatagcacagcctcctcagccaacgcaacct
ccacagcagccgaatgtctcctcagcataa

DBGET integrated database retrieval system