KEGG   Mus musculus (mouse): 72040Help
Entry
72040             CDS       T01002                                 

Gene name
Cdhr5, 1810074H01Rik, AI481143, Mucdhl, Mupcdh
Definition
(RefSeq) cadherin-related family member 5
  KO
K16505  cadherin-related family member 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    72040 (Cdhr5)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Cadherin related
   72040 (Cdhr5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_3
Motif
Other DBs
NCBI-GeneID: 72040
NCBI-ProteinID: NP_001107794
MGI: 1919290
Ensembl: ENSMUSG00000025497
Vega: OTTMUSG00000060283
UniProt: Q8VHF2 A0PJK7
Position
7; 7 F5
AA seq 831 aa AA seqDB search
MGAPALLWPSLLLPWLTVLFGQPPGTLAQTQVCSVNQTIFRVEENTTVSEPLVNIFVPDG
LHVTLGPLSTPYAFRIEGKDLFLNVTPDYEENSLLQADVECKRGDAVVVRLEVFVAVLDI
NDNAPKFSFEIKTFNVSEDTKVNTTVIPETQLKATDADINDILVYTLQEVTPNASKFFSL
EGVNYPALKLDQTLDYFKNQNMTFMLLARDTWEENVEPSHTATATLVLNTLPADLRTPWF
LPCSFTDGYVCIHAQYSAVVPTGHKLPSPLIMSPGPIYAVDGDQAINQSIIYSIIAGNTD
GTFIINAHDGNLTMTKSIPSPMKFTLLIRADQEDMAQYSVTQAIVEARSVTGNPLQFSQS
LYYGTVVLGSEAGTAVKDKTFPSEILRIQAQYPGFPDLNSAVTYRVTNSSEFMMNKDIML
TAVPMEEARTIRVEVEASNTVTKDTATAVVEIQVSERELPSTEFPTPPEAGGTTGPSSNT
TMEAPLTSGTSQRPATTSSGGSVGPFPPGGTTLRPPTPASSIPGGSPTLGTSTSPQTTTP
GGDSAQTPKPGTSHPTAPTSRTSTSLMTTSSRSDSTQTPKPGTSQPMVPIPGASTSSQPA
TPSGSSPQTPKPGTSQSTATGPISGAGEQGDGQRFSTVDMAVLGGVLGALLLLALICLVI
LVHKHYRHRLACCSGKASEPQPSGYDNLTFLPDHKAKWSPTPNRKPEPSPKLAQPPLRPP
SPMSSSPTPPSSTPPSPQPKASGSPKTVQAGDSPSAVRSILTKERRPEGEGGYKAVWFGK
DIGAEADVVVLNEPTADVDSASASGSEGSDDDDPDQKKTLRFGVDADNTYI
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgggggctccggccctcctgtggccttccctgctgttgccatggctcacagtgctgttt
ggccaacctccggggaccttggcccagacccaggtctgctctgtgaaccagaccatattt
agagtcgaggagaacaccactgtttctgagccactggtgaacatttttgtcccagacggc
ctgcacgtgaccttgggacccttgtccactccttatgcctttaggatcgaaggaaaagat
ctgtttctcaacgtgactccagattatgaggaaaactcattgctccaggcagatgtggag
tgtaagagaggagatgcggtggtggtacgcctggaggtgtttgtggctgtcctggatatc
aatgacaatgcgccaaaattctcctttgaaatcaagacatttaatgtatcggaggacacc
aaagtgaatacaaccgtcatccctgagacacagctgaaggctacagatgctgacataaat
gacatcctagtctacactctgcaggaagtgacccccaatgccagcaagttcttctccctg
gagggcgtaaactaccctgctctgaagttggaccagaccctggattacttcaagaatcag
aacatgaccttcatgctgctggcacgggatacttgggaggaaaatgtagagcccagccac
acggccactgccaccctggtcttgaacacgctgccagctgacctacggaccccctggttc
ctgccatgctccttcacagatggctatgtctgcattcatgcccaatacagtgcggttgtc
cccacgggacacaaactgccgtcccccctcatcatgagtcctggtcccatctatgctgtg
gacggagatcaggccattaaccagtctatcatctacagcattatagcgggaaacacagat
ggcacattcatcatcaacgcacacgatggcaacctcacaatgaccaaaagtatcccgagc
cccatgaagttcacccttctgatcagggctgatcaggaagacatggctcaatactcagtg
acccaggccatcgtggaggctcgcagtgtcactggaaacccactccagttctcccagagc
ctgtactatggcacagtggtactgggatctgaggctggcacagcagtgaaggacaagacc
ttcccttcggagatcctgaggatccaggctcagtacccaggcttcccggacctcaactca
gctgtcacatatcgagtcaccaactcctcagaattcatgatgaataaggatatcatgctg
actgctgtgcctatggaggaagcaagaaccatccgtgtagaggtagaagctagcaatact
gtgactaaggacacagccaccgctgttgttgagatccaggtgtcagagcgagaactgccc
tccacagagttccccacacccccagaagctggaggaacgactgggccttcaagtaacacc
actatggaagcccccttgacctctgggacctctcaaagacctgccaccaccagctctggg
ggaagtgttggcccattcccacctggtggcacaactctaagaccacccacccctgcctca
tccatacctggggggtcccctactcttggaaccagcacctctccccagacaaccactcct
ggtggggactcagcacagacccccaaaccaggaacctctcatccaacagcccctacttcc
agaacaagtacctccctcatgacaacctcatccagaagtgactcaacacagacccccaag
ccaggaacctctcagccaatggtccccattccaggggccagcacctcttctcagccagcc
acacctagtggcagctcaccacagacccccaagccaggaacctctcagtcaacagccact
gggcccatctcaggagcaggcgagcagggtgatggccagagattttccacggtggacatg
gcagtgttgggcggggtgctaggtgcactgctgttgctggccctcatctgcttggtcatc
ctcgtccataagcactaccgacatcggctcgcttgttgctctgggaaggcttcggagcca
cagccaagtggctatgacaacctgaccttcctcccagaccacaaggccaagtggtcgccc
acccccaaccggaagccagagccgagccccaagcttgcccagccgcccctccggcctcct
agccccatgtcctccagtcctacgccccccagctccacacctcctagccctcagcccaaa
gcttccgggtctcctaagacagtccaggctggggacagcccttcagccgtgaggtctatc
ctgactaaggagcggcggccggagggggagggcggctacaaggctgtgtggttcggcaag
gacatcggggcagaggctgacgtggtggtcctcaacgagcccaccgccgatgtggacagc
gccagtgcctcgggaagtgagggcagcgatgatgatgaccctgaccagaagaagactctc
cgctttggcgtggatgctgacaacacttacatctag

DBGET integrated database retrieval system