KEGG   Mus musculus (house mouse): 72053
Entry
72053             CDS       T01002                                 
Symbol
Tmub2, 2010008E23Rik
Name
(RefSeq) transmembrane and ubiquitin-like domain containing 2
  KO
K23340  transmembrane and ubiquitin-like domain-containing protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72053 (Tmub2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    72053 (Tmub2)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD_2 Dsc3_N
Other DBs
NCBI-GeneID: 72053
NCBI-ProteinID: NP_001289434
MGI: 1919303
Ensembl: ENSMUSG00000034757
UniProt: Q3V209
Structure
Position
11:102175777..102180253
AA seq 319 aa
MISRLLQNNLMSVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVALTLALVLAWLSTYVAD
SGNNQLLGTIVSAGDTSVLHLGHVDQLVNQGTPEPTEHPHPSGGNDDKAEETSDSGGDAT
GEPGARGEMEPSLEHLLDIQGLPKRQAGLGSSRPEAPLGLDDGSCLSPSPSLINVRLKFL
NDTEELAVARPEDTVGTLKSKYFPGQESQMKLIYQGRLLQDPARTLSSLNITNNCVIHCH
RSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFTGPATI
SLVGVTVFFSILVFGMYGR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgatttcacgtcttcttcaaaacaaccttatgagcgtggacccagtcagcagccaggcc
atggagctctctgatgtcaccctcattgagggtgtgggtaacgaggtgatggtggtagca
ggcgtggtggcgctgactctagccctggtcctagcctggctctccacctatgtagcagac
agtggtaacaaccagctgctgggcaccattgtgtcagcaggtgacacgtctgttctccac
ctgggccatgtggaccagctggtaaaccaaggcactccagagccaaccgaacacccccat
ccatcagggggcaatgatgacaaggctgaagagaccagtgacagtgggggagacgccact
ggagaacctggagctaggggagagatggagcccagcctggagcatctcctggacatccaa
ggcctgcctaaaaggcaagcaggcctggggagcagtcgcccagaagccccgctggggtta
gatgatggctcctgcctctctcccagccccagcctcatcaatgttcgcctcaagttcctc
aatgacaccgaggagctagctgtggccaggccagaggacactgtgggtaccctaaaaagc
aaatacttccctggacaagagagccaaatgaagttgatctaccagggtcggctgctgcag
gacccagcacgcacactgagttccctgaacattaccaacaactgcgtgatccactgccac
cgctcacccccaggggcagcagtttctggcccctcagcctccttgaccccaaccactgag
caatctagccttggtgtcaacgtgggcagcctcatggtgcctgtgtttgtggtgctcttg
ggtgtggtctggtacttccgtatcaattaccgccagttcttcactggacctgccactatc
tccttggttggagtcacagtcttcttcagcatcctggtatttgggatgtatggaagataa

DBGET integrated database retrieval system