KEGG   Mus musculus (house mouse): 72058
Entry
72058             CDS       T01002                                 
Symbol
Igsf5, 2010003D20Rik, JCAM, Jam4
Name
(RefSeq) immunoglobulin superfamily, member 5
  KO
K06786  junctional adhesion molecule 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    72058 (Igsf5)
SSDB
Motif
Pfam: Ig_3 I-set ig MAP17 WBP-1 Orthoreo_P10 EphA2_TM Tetraspanin Prominin TMEM52 LYRIC TMIE V-set TMEM154 Rhabdo_glycop Ac76 FAM176 DUF4834 Mucin Cadherin_C_2 Tweety Sigma_reg_N SIT
Other DBs
NCBI-GeneID: 72058
NCBI-ProteinID: NP_082354
MGI: 1919308
Ensembl: ENSMUSG00000000159
UniProt: Q7TSN7 A0A0R4J105
Position
16:96162676..96266772
AA seq 270 aa
MEGSWRDVLAVLVILAQLTASGSSYQIIEGPQNVTVLKDSEAHFNCTVTHGWKLLMWTLN
QMVVLSLTTQGPIITNNRFTYASYNSTDSFISELIIHDVQPSDSGSVQCSLQNSHGFGSA
FLSVQDSIGEEGPALPTWAIILLAVAFSLLLILIIVLIIIFCCCCASRREKEESTYQNEI
RKSANMRTNKADPETKLKSGKENYGYSSDEAKAAQTASLPPKSAEVSLPEKRSSSLPYQE
LNKHQPGPATHPRVSFDIASPQKVRNVTLV
NT seq 813 nt   +upstreamnt  +downstreamnt
atggagggcagctggagagatgtcctggctgtgctggtcatcctggctcagctgacagct
tccggatccagttatcagatcatagaaggtcctcagaatgtaacagtcctaaaggactca
gaggctcacttcaactgcaccgtgactcacggctggaagcttctcatgtggactcttaac
caaatggtggtgctgagtctcaccacccaaggacccatcatcaccaacaaccgcttcacc
tatgccagttacaacagcactgacagcttcatctcggagttgatcatccatgatgtgcag
cccagtgactcgggatccgtgcaatgcagcctgcagaacagccatgggtttggatctgcc
ttcctctcagtgcaagacagtattggagaggaaggcccagcactgccgacctgggccatc
atcctgctggcagtggccttttccttgctcttgatcctgatcattgttttgattataata
ttctgttgctgttgtgcctccaggagagaaaaggaagaatctacttatcaaaatgaaata
aggaaatctgcaaacatgaggacaaacaaagcagatccggagacaaagttaaaaagtgga
aaggaaaactacgggtacagttcggatgaggcaaaggctgcacagactgcatctctccct
cctaaatctgctgaagtcagccttccagaaaaacgcagcagtagccttccttatcaggaa
ctcaataaacatcagcccggtccagcaactcatccacgggtttcctttgacatcgccagt
cctcagaaggtcagaaatgtgactttagtgtaa

DBGET integrated database retrieval system