KEGG   Mus musculus (mouse): 72065
Entry
72065             CDS       T01002                                 

Gene name
Rap2c, 2010200P20Rik, AI194294, AL022976
Definition
(RefSeq) RAP2C, member of RAS oncogene family
  KO
K07839  Ras-related protein Rap-2C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    72065 (Rap2c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    72065 (Rap2c)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    72065 (Rap2c)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N TPP_enzyme_M MMR_HSR1_Xtn AAA_24
Other DBs
NCBI-GeneID: 72065
NCBI-ProteinID: NP_766001
MGI: 1919315
Ensembl: ENSMUSG00000050029
Vega: OTTMUSG00000017471
UniProt: Q8BU31
Position
X; X A5
AA seq 183 aa
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG
TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDL
EPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTC
VVQ
NT seq 552 nt   +upstreamnt  +downstreamnt
atgagggaatacaaggtagtggtgttagggagcggaggggttggcaaatctgccctcacc
gtgcagtttgtcaccgggactttcattgagaaatatgaccccaccattgaagatttctac
cgcaaagagatcgaagtggactcttccccgtcagtactggaaatcctggacaccgcagga
accgagcagtttgcctccatgagagatctgtacatcaagaacggccaaggtttcatcctg
gtgtatagtttggttaatcaacagtcttttcaggatatcaagccaatgagagatcagatt
gtgagagtgaagagatacgagaaagtcccactcatcctagtgggaaacaaagtggatctg
gaaccagagagagaggttatgtcttccgaaggcagagctctggctcaagaatggggctgt
cctttcatggaaacgtcagcaaaaagtaaatcaatggtggatgaactttttgctgagatc
gtcaggcaaatgaactattcatccctgcccgagaagcaagatcagtgttgtacaacttgt
gttgtccagtaa

DBGET integrated database retrieval system