KEGG   Mus musculus (mouse): 72088
Entry
72088             CDS       T01002                                 

Symbol
Ush1c, 2010016F01Rik, harmonin
Name
(RefSeq) USH1 protein network component harmonin
  KO
K21877  harmonin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    72088 (Ush1c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    72088 (Ush1c)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Baculo_LEF5_C
Other DBs
NCBI-GeneID: 72088
NCBI-ProteinID: NP_710143
MGI: 1919338
Ensembl: ENSMUSG00000030838
Vega: OTTMUSG00000025998
UniProt: Q9ES64 E9QMN1
Structure
PDB: 
1V6B

Position
7 B3; 7 29.66 cM
AA seq 910 aa
MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPNRLPLFD
AIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLIKG
GQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIKVRHIGLIPVKSSPEESL
KWQYVDQFVSESGGVRGGLGSPGNRTTKEKKVFISLVGSRGLGCSISSGPIQKPGIFVSH
VKPGSLSAEVGLETGDQIVEVNGIDFTNLDHKEAVNVLKSSRSLTISIVAGAGRELFMTD
RERLEEARQRELQRQELLMQKRLAMESNKILQEQQEMERQRRKEIAQKAAEENERYRKEM
EQISEEEEKFKKQWKEDWGSKEQLILPKTITAEVHPVPLRKPKSFGWFYRYDGKFPTIRK
KAKEKKKAKYDSLQDLRKNKKELEFEQKLYKEKEEMLEKEKQLKINRLAQEVSETEREDL
EESEKTQYWVERLCQTRLEQISSAENEIPEMTTGPPPPPPSVSPLAPPLRRFAGGIHLHT
TDLDDIPLDMFYYPPKTPSALPVMPHPPSVNPPSKVPAPPVLPSSGHVSSSSSPWVQRTP
PPIPIPPPPSIPTQDLTPTRPLPSALEEALGNHPFRTGDPGHPADDWEANTHSGKPSSSP
TTERSFPPAPKTFCPSPQPPRGPGVSTISKPVMVHQEHNFVYRPAVKSEVLPQEMLKRMV
VYQTAFRQDFRKYEEGFDPYSMFSPEQIAGKDVRLLRIKKEGSLDLALEGGVDSPVGKVV
VSAVYEGGAAERHGGVVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVC
PPKEYDDELSSLPSSAAESPQLARKQLEAYEPVCRHGFFLQLEPTNLLLKSRERNQTDPS
WRPASSAPSP
NT seq 2733 nt   +upstreamnt  +downstreamnt
atggaccggaaggtggcccgagaattccgacacaaggtggattttctcattgaaaatgac
gcagagaaggactatctttatgatgtgctgcggatgtatcaccagaccatggatgtggct
gtgctcgtgggagacctgaagctggtcatcaatgaacccaaccgcctgccgctgtttgat
gccattcgacccctgatcccactgaagcaccaggtggagtatgaccagctgacaccccga
cgctccaggaaactgaaggaggtacgcttggaccgtctgcacccagaaggtctcggcctc
agcgtgcgtggaggcctggaatttggctgtggactctttatctcccacctcatcaaaggt
ggccaggcagacagcgttgggcttcaggtaggggatgaaattgtccggatcaacggctat
tccatctcttcctgtacccatgaggaagtcatcaacctgatccgcaccaagaagaccgtg
tccatcaaagtgagacacatcggactgatccctgtgaagagctctcctgaggagtccctc
aaatggcagtatgtggatcagttcgtgtcggaatctgggggtgtgcgaggtggcttgggc
tcacctggcaatcggacaaccaaggagaagaaggtgtttatcagtctagtgggctctcgg
ggcctgggctgcagcatctccagtggccccatccagaagcctggcatcttcgtcagccac
gtgaagcctggctccctgtctgcagaggtggggttagagacaggagaccagattgtggaa
gtcaacggcatagacttcaccaacctggaccacaaggaggctgtgaatgtcctgaagagc
agccgcagcctgaccatctccatcgttgctggagccggccgggagctgttcatgacggac
cgggaacggctggaggaggcacggcagcgtgagctgcaacggcaggaactcctcatgcag
aagcggctggccatggagtccaacaagatcctccaggagcagcaggagatggagcgccag
aggagaaaggagatcgcccagaaggctgccgaggagaatgagagataccggaaggagatg
gaacagatctcggaggaggaagagaagtttaagaagcagtggaaagaagactggggttca
aaggagcagctcattctgcctaagaccatcaccgcagaggtgcacccggtgccccttcgc
aagcccaagtcttttgggtggttttaccgttacgatggcaaattcccaaccatccggaag
aaagcaaaagagaagaagaaagccaagtacgatagcctgcaggacctgaggaagaacaag
aaggaactcgagtttgaacaaaagctctacaaagagaaggaagagatgctggagaaggag
aagcagctcaagatcaaccggctggcccaggaggtgtctgagactgagcgggaagacctt
gaggaatcggaaaagactcagtattgggtggagaggctctgtcagacgcgcctcgagcag
atttcctctgcagagaatgagattcctgagatgaccacagggcccccacctcccccacct
tctgtgtctcctctggccccacccttgagacgattcgctggtgggatccacctccacacc
actgacctggatgacatccccttggacatgttctactacccccccaagactccctcagca
ctgcccgtgatgccccaccctccatctgtcaacccaccttccaaggtccccgcgccccct
gtgcttccctcatcaggtcacgtgagcagctcatcctcaccatgggtgcaacgcactcct
cccccaatccccattcctccgcctccatccattcccacccaagacctcactcctacccgc
ccattgccctcagcactggaagaggccctgggcaaccaccccttccgcactggggaccca
ggccatccagcagatgactgggaggcaaacacccacagtgggaagccctccagctccccc
accactgagcggagcttcccacctgccccaaagacattctgcccaagcccacagcctcca
cgaggccctggcgtgtccaccatctccaaacccgtcatggtccaccaggaacacaacttc
gtctacaggcctgctgtgaagtccgaggttctgccgcaggagatgctgaagaggatggtg
gtatatcagacagcattcagacaagattttcgaaaatacgaagaaggctttgatccctac
tccatgttctcgccagagcagatcgcagggaaggacgtccggcttctgcgaatcaagaag
gaggggtctttagacttggccctggagggaggcgtggactcccccgtggggaaggtggtc
gtctctgctgtttatgaagggggagctgcggagaggcatggtggcgttgtgaaaggggat
gagatcatggccatcaatggcaagattgtgacggactacaccctggctgaggccgaggct
gccctacagaaggcctggaatcagggcggggactggatagaccttgtggttgctgtctgt
ccccctaaggagtatgatgacgagctctcttctcttccctcctctgcagccgaaagcccc
cagctggcccgaaagcagcttgaagcctatgagcccgtgtgtagacacgggtttttcctg
cagctggagcccacgaaccttcttttaaagtccagagagagaaaccagacagacccatcc
tggaggccggcgagctccgcacccagcccctga

DBGET integrated database retrieval system