KEGG   Mus musculus (house mouse): 72098
Entry
72098             CDS       T01002                                 
Symbol
Tmem68, 2010300G19Rik, Diesl, MGAT/DGAT
Name
(RefSeq) transmembrane protein 68
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Acyltransferase DAGAT
Other DBs
NCBI-GeneID: 72098
NCBI-ProteinID: NP_082373
MGI: 1919348
Ensembl: ENSMUSG00000028232
UniProt: Q9D850
Position
4:complement(3549041..3574853)
AA seq 329 aa
MIDNNQTCAAGQDSVPYVTCMIYVLEEWLGVEQLEDYLNFANHLLWVFTPLILLILPYFT
IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE
GAALIIFYHGAIPIDFYYFMAKIFIQKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPRE
KCVEILRSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQVAIDAKVPIIPMFTQNIRE
GFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPIPYDPKVTAEELAEKTKNAV
QALIDKHQRIPGNIRSALLDRFHKEQKAH
NT seq 990 nt   +upstreamnt  +downstreamnt
atgatagataacaaccaaacctgtgctgcaggacaggactctgtgccctatgtgacctgt
atgatttatgtgcttgaggagtggttgggtgtggagcaattggaggactatctgaatttt
gcaaaccatcttttgtgggttttcaccccactgatacttttaatacttccttattttacc
atctttcttctctaccttactattattttcctccatatctacaagaggaagaatgtatta
aaagaagcctactctcataacttgtgggatggtgcaaggaaaacggtggcaactctgtgg
gatggacatgcggctgtttggcatggttatgaagttcatgggatggaaaagataccagaa
ggagctgcacttataattttttatcatggagccatccccatagacttttactacttcatg
gctaaaattttcatccagaaaggcagaacttgccgagtagtagctgaccactttgtcttt
aaaattccagggttcagtttattacttgatgtgttttgtgctcttcatggaccaagagaa
aaatgtgttgaaatcttgaggagtggtcacttgttagctatctcaccgggcggagttcga
gaagccttacttagtgatgaaacctacaacatcatatggggtaatcgtaaaggctttgct
caggttgcaattgatgcaaaagtgcccattattcctatgtttacacaaaatattcgagaa
ggatttagatcacttggaggcacaagattatttaagtggctttatgaaaaattccgctat
ccatttgctccaatgtatggaggttttcctgtaaagttgcggaccttcttaggtgatccc
ataccatatgacccaaaggtaacagcagaagaattagccgaaaagaccaagaatgctgtt
caagctttgattgacaagcaccaaaggataccggggaacattaggagtgctctgctggac
cgctttcataaagagcagaaggctcattag

DBGET integrated database retrieval system