KEGG   Mus musculus (mouse): 72106
Entry
72106             CDS       T01002                                 

Gene name
Jmjd8, 2610003J06Rik
Definition
(RefSeq) jumonji domain containing 8
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Cupin_8 Cupin_4 JmjC Cupin_2 Cupin_1
Other DBs
NCBI-GeneID: 72106
NCBI-ProteinID: NP_082377
MGI: 1919356
Ensembl: ENSMUSG00000025736
Vega: OTTMUSG00000029400
UniProt: Q3TA59
Position
17; 17 A3.3
AA seq 269 aa
MAAAGRRGLLLLFVLWMMVTVILPASGEGGWKQNGLGIAAAVMEEERCTVERRAHITYSE
FMQHYAFLKPVILQGLTDNSKFRALCSRENLLASFGDNIVRLSTANTYSYQKVDLPFQEY
VEQLLQPQDPASLGNDTLYFFGDNNFTEWASLFQHYSPPPFRLLGTTPAYSFGIAGAGSG
VPFHWHGPGFSEVIYGRKRWFLYPPEKTPEFHPNKTTLAWLLEIYPSLALSARPLECTIQ
AGEVLYFPDRWWHATLNLDTSVFISTFLG
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcggcggctgggcggcgcggtctgcttttgctctttgtactatggatgatggtgact
gtgattctgcctgcctctggcgaagggggatggaaacagaatgggctgggaattgcagca
gcagtaatggaggaggagcgttgcacagtggagcgtcgggcacacatcacgtactccgaa
ttcatgcagcactatgccttcctcaagcccgtcatcttgcaaggactcacggacaactcg
aagttccgggccctgtgttcccgggaaaacctgctagcctcgttcggggacaacattgtt
cgcttgagtacagccaacacctactcctaccagaaagtggacctgcccttccaggaatat
gtggaacagctgctgcagccccaggatcctgcatccctaggcaatgacaccctgtacttt
tttggagacaacaacttcactgagtgggcatccctcttccagcactactctccgccacca
ttccgtctcctgggaaccacccctgcttacagctttggaattgcaggagctggatctggg
gtacccttccactggcatgggcctggtttctcagaggttatctatggtcggaagcgctgg
ttcctctaccctcctgagaagacacctgagttccaccctaacaagaccacattggcctgg
ctgctggaaatatacccatctctagccctgtcagcacggcctctagaatgtaccatccag
gctggtgaagtactgtattttcctgatcggtggtggcatgccacactcaatctggacacc
agtgtcttcatttctaccttccttggctag

DBGET integrated database retrieval system