KEGG   Mus musculus (mouse): 72112Help
Entry
72112             CDS       T01002                                 

Gene name
Ppp1r14d, 2010107K19Rik, GBPI-1, Ppp1r14
Definition
(RefSeq) protein phosphatase 1, regulatory inhibitor subunit 14D
  KO
K17557  protein phosphatase 1 regulatory subunit 14D
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    72112 (Ppp1r14d)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     72112 (Ppp1r14d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP1_inhibitor
Motif
Other DBs
NCBI-GeneID: 72112
NCBI-ProteinID: NP_082380
MGI: 1919362
Ensembl: ENSMUSG00000027317
Vega: OTTMUSG00000015879
UniProt: Q7TT52
Position
2; 2 E5
AA seq 146 aa AA seqDB search
MLSSSPASCTSPSPGTDNPDKKVHWASEKRRRASSTDSESKTHLDISKLPRSRRPSRLTV
KYDRGHLQRWLEMEQWVDAQVQELFQGQEESSEPEIDLEALMDLSTEDQRTQLEAILQDC
PGNREPFISELLSQLKRLRRLSRPSK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttcaagccctgcttcctgtacatctcccagccctggcacagacaacccagac
aagaaggtccactgggcttctgagaagagaaggagggcatcgtccacagactcagagtca
aagactcacttggacatttctaagttgcccaggtcccggagacccagccggctgacggtg
aagtatgaccggggtcatctgcagcgctggctggagatggagcagtgggtagatgctcag
gtccaggaactcttccagggtcaagaagaatcttctgagccagagattgatctggaagct
ctcatggacttgtcaacagaagatcaaaggacacagctggaggccattctccaagactgc
ccaggcaacagagagccttttatctctgagctactcagtcaactcaagagacttcggaga
ctcagcaggccttcgaaataa

DBGET integrated database retrieval system