KEGG   Mus musculus (mouse): 72129
Entry
72129             CDS       T01002                                 

Gene name
Pex13, 2610008O20Rik
Definition
(RefSeq) peroxisomal biogenesis factor 13
  KO
K13344  peroxin-13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    72129 (Pex13)
SSDB
Motif
Pfam: Peroxin-13_N SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 72129
NCBI-ProteinID: NP_076140
MGI: 1919379
Ensembl: ENSMUSG00000020283
Vega: OTTMUSG00000005277
UniProt: Q9D0K1
Structure
PDB: 
1WXU

Position
11; 11 A3.2
AA seq 405 aa
MASQPPPPPKPWESRRIPGAGPGPGSGPGPTYQSADLGPTLLTRPGQPTLTRVPPPILPR
PSQQTGSNNVNTFRPAYSSFSSGYGAYGNSFYGSYSPYSYGYNGLGFNRLRVDDLPPSRF
VQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKV
FSAFALVRTIRYLYRRLQWMMGLRRGSENEDLWAESEGTVACLSAEDQATNSAKSWPIFL
FFAVILGGPYLIWKLLSTHNDEVTDNTNWASGEDDHVVARAEYDFVAVSDEEISFRAGDM
LNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTIESSTMLKQQQSFTNP
TLIKGVTTTNPLDEQEAAFESVFVETNKVSSAPDSTGKNGDKQDL
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcctcccagccgccgccgccccccaaaccctgggagtctcgcagaattcccggggcc
ggccccgggccgggctccggccccggccccacttaccaatctgctgatttgggccctact
ttattgacaagacctggacaaccaacacttacaagagtgcccccgcctattcttcccagg
ccatcccagcagacagggagcaacaatgtaaacactttcagacctgcttacagttcattt
tcttctggatatggagcctacggaaattcattttatggaagctatagcccttatagttat
ggatacaatggtttgggctttaaccgcctccgtgtagatgatcttcctcccagtaggttt
gttcagcaagctgaagaaagcagcagaggtgcatttcagtccattgaaagtattgtgcat
gcatttgcctctgtcagcatgatgatggatgctaccttttcagccgtctataacagtttc
agggctgtattggatgtagcaaatcacttttcccggctaaaaatacactttacaaaggtt
ttttcagcctttgcattagttaggactataagatatctttatagacggttacagtggatg
atgggtttaagaagaggctctgagaatgaggacctgtgggcagaaagtgaaggaactgtg
gcctgccttagtgctgaggaccaggcaactaactcagcaaaatcttggccaatattcctg
ttctttgctgttatccttggcggtccttatctcatctggaaacttctatctacacacaat
gatgaagtaacagacaacaccaactgggcaagtggtgaggatgaccacgtagttgcaaga
gcagagtacgattttgttgccgtgtctgatgaagaaatttctttccgtgctggtgatatg
ctaaatttagccctcaaagaacaacaacccaaagtgcgtggttggcttctggctagtctt
gacggtcaaacaacaggacttatacctgcaaattatgtcaaaattcttggtaaaagaaga
ggcagaaaaacaatagaatcgagtacaatgctcaagcaacaacagtcttttaccaaccca
acattaattaaaggagtcactaccaccaatcctttggatgaacaggaagctgcctttgaa
tctgtttttgttgaaactaataaggtttccagtgcacctgattctacagggaaaaatgga
gacaaacaagatctttga

DBGET integrated database retrieval system