KEGG   Mus musculus (mouse): 72135
Entry
72135             CDS       T01002                                 

Symbol
Pygo1, 2600014C22Rik
Name
(RefSeq) pygopus 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PHD Prok-RING_1 zf-RING_2 zf-RING_11 PHD_4 FANCL_C
Other DBs
NCBI-GeneID: 72135
NCBI-ProteinID: NP_082392
MGI: 1919385
Ensembl: ENSMUSG00000034910
Vega: OTTMUSG00000027456
UniProt: Q9D0P5 Q1JPR5
Structure
PDB: 
2YYR 2DX8

Position
9; 9 D
AA seq 417 aa
MSAEQDKEPIALKRVRGGDSGLDGLGGPNIQLGSPDKKKRKANTQGSSFPPLSEYAPPPN
PNSDHLVAANPFDDSYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCG
PYSLRNQPHPFPQNPLGMGFNRPHAFNFGPHDNSNFGNPPYNNVLTQDINMPGQHFRQGS
AENFSQIPPQNVGQVSNPDLASNFAPGNNSNFTSPLETNHSFIPPPNAFGQAKAPLPKQD
FTQGATKTPNQNSSTHPPHLNMEDPVNQSNVELKNVNRNNVVQENSRSGSAEATNNHANG
TQNKPRQPRGAADLCTPDKSRKFSLLPSRHGHSSSDPVYPCGICTNEVNDDQDAILCEAS
CQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTREAFGPPAVGGDA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtcagcggaacaggacaaggagcccatcgcgctgaagagagttagaggtggtgacagt
ggactggatgggttaggagggcccaatatacaactcggaagcccagataagaaaaaacgc
aaggccaacacacagggatcttcctttcctccgctgtcagagtacgcgccaccaccgaat
ccaaactccgaccatctagtggctgccaatccgttcgatgacagctacaacaccatttcc
tataaaccactgccttcatctaatccatatcttggccctgggtatcctggctttggaggc
tacagcacattcagaatgccaccccacgtccctccaagaatgtcttctccctactgtggt
ccttactcactcaggaatcagccccacccatttcctcagaatccgttgggcatgggcttt
aaccggcctcatgcttttaactttgggccgcatgataattcgaattttggaaacccacct
tataataatgtactgactcaggacattaacatgcccggtcagcattttagacaaggctct
gctgaaaacttcagtcagattcccccgcagaatgttggccaagtgtctaaccctgacctc
gcatctaattttgcccctgggaataattcaaattttacctctccgttagaaacgaatcat
tcgtttattccacccccaaacgcgtttggccaagcaaaagctccacttcccaaacaagac
ttcactcaaggggcaaccaaaaccccgaatcagaattcgtccactcacccacctcaccta
aatatggaggatccagtcaatcagagtaacgtcgagttaaaaaatgtcaacagaaacaac
gttgtccaagagaacagccgttcgggcagcgcagaggccaccaacaaccatgcgaatggg
acccagaacaagccccggcagcccaggggcgcagctgacctgtgcacccccgacaaaagc
cgcaagttctccctgctccccagccggcatggccattcctcctctgaccctgtgtacccg
tgcgggatttgtacaaatgaagtgaatgacgatcaggacgccattctgtgtgaagcctct
tgtcagaagtggtttcatcgcatctgcactggaatgaccgaaacagcctacgggctcctg
acagcggaagcatccgcagtgtggggctgtgacacgtgcatggctgacaaggatgtccag
ctcatgcgcactagagaggcctttggtccacctgccgtgggcggcgatgcctaa

DBGET integrated database retrieval system