KEGG   Mus musculus (mouse): 72136Help
Entry
72136             CDS       T01002                                 

Gene name
Chst14, 2600016L03Rik, D4ST-1, D4st1
Definition
(RefSeq) carbohydrate sulfotransferase 14
  KO
K08105  dermatan 4-sulfotransferase 1 [EC:2.8.2.35]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    72136 (Chst14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    72136 (Chst14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.35  dermatan 4-sulfotransferase
     72136 (Chst14)
Glycosyltransferases [BR:mmu01003]
 Unclassified
  Sulfotransferases
   72136 (Chst14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 72136
NCBI-ProteinID: NP_082393
MGI: 1919386
Ensembl: ENSMUSG00000074916
Vega: OTTMUSG00000015639
UniProt: Q80V53
Position
2; 2 E5
AA seq 376 aa AA seqDB search
MFPRPLTPLAAPKSAETLGRTPRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMI
ERGILSEMKPLPLHPPSHKGAAWSGTDPKPRGLSLDAGDSDLQVREDIRNRTLRAVCGQP
GMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVLKVLAGILNNVDVRL
KMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVRDPLERLLSAYRNKFGEIREYQQRYGAE
IVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPEHMNEHWMPVYHLCQPCAVHYDFVGSYE
RLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCNVPRALLQDVLPKYILDFS
LFAYPLPNVTKEACHQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtttccccgccctctgaccccactggctgccccgaaaagcgcggagaccctgggccgc
acgccaaggcgggccccattgggccgggcccgggctgggctcggggggccgcccctgctg
ctgccgtccatgctgatgttcgctgtaatcgtggcctccagcggactgctgctcatgatc
gagcgaggcatcctatcggagatgaaaccccttcccctgcaccctcccagccacaaaggc
gcggcctggagcgggacagatcctaagcctagaggcctatccttggatgctggggactcg
gacttgcaagtgagggaggacatccgaaaccggaccttgagggccgtgtgcggacaacca
ggcatgccccgggacccctgggacttgccggtgggacagcggcgcaccctgctgcgccac
attctcgtaagtgaccgctaccgcttcctctactgctatgtccccaaagtggcctgctct
aactggaaacgtgtgctgaaggtgctggctggcatcctgaacaacgtggatgtccgcctc
aagatggaccaccgcagtgacttggtgtttctggcagacctgcggcctgaggagattcgc
taccgtctgcagcactacttcaagttcctgtttgtgcgagaccccttggaacgcctcctg
tctgcttaccgtaacaagtttggagagatccgagagtaccagcagcgatatggggccgaa
attgtcaggcgctacagggctggagctggccccagccctgcaggggacgatgtcaccttc
ccagagttcctgagatacctggtggatgaggatcctgaacatatgaatgagcattggatg
cctgtgtaccacctgtgccaaccatgtgctgtgcactacgacttcgtgggttcctatgag
aggctggaggctgatgccaaccaggtgctggagtgggtgcgggccccaccccatgtccgg
ttcccagctcgccaggcctggtaccggccagccagcccagaaagtctgcattaccacttg
tgcaatgttccacgggccctgcttcaagatgtgctacctaagtatatcctggacttctcc
ctctttgcttacccactgcccaatgtcaccaaggaagcctgtcaccaatga

DBGET integrated database retrieval system