KEGG   Mus musculus (mouse): 72141Help
Entry
72141             CDS       T01002                                 

Gene name
Adpgk, 2610017G09Rik, Adp-gk, C77577
Definition
(RefSeq) ADP-dependent glucokinase
  KO
K08074  ADP-dependent glucokinase [EC:2.7.1.147]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    72141 (Adpgk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.147  ADP-specific glucose/glucosamine kinase
     72141 (Adpgk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_PFK_GK
Motif
Other DBs
NCBI-GeneID: 72141
NCBI-ProteinID: NP_082397
MGI: 1919391
Ensembl: ENSMUSG00000025236
Vega: OTTMUSG00000063291
UniProt: Q8VDL4 A0A1L1SSF2
Structure
PDB: 

Position
9; 9 B
AA seq 496 aa AA seqDB search
MALWRGSACAGFLALAVGCVFLLEPELPGTALRSLWSSLRLGPAPVPVGPLSPESRLAAA
WDALIAQPARRWRRVAVGVNACVDVVISGVKLLQALGLSPGSGKDHAILHSRSDLEEAFL
YFMGKGAAAERFFSDKETFHDIAQAASEFPGAQHYVGGNAALIGQRFAANTDLKVLLCGP
IGPKLHELLDDNVFVPPESLQEEDEFHLILEYLAGEEWGPFKAPHANRFIFSHDLSNGAM
NMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTAISDIPTGIPVHLELAS
MTNRELMSSIVHQQVFPTVASLGLNEQELLFLSQSASGPHASLSSWDGVPDVGMVSDILF
WILKEHGRSENRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETI
DTNRVSLRAPQEFTTSHLESGSRIVLNPDKPVVEWHREGITFHFTPVLVCKDPVRTVGLG
DAISAEGLFYSEARPD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtggcgcggctctgcgtgcgccggcttcctggcgctggccgtgggctgcgtg
ttcctgctggagccggagctgccgggcacggcgctgcgctcgctctggagctccctgagg
ctgggacccgcgccagtgcccgtgggacctctgtccccggagagccggctggcagccgct
tgggacgccctcatcgcgcagcccgcccggcgctggcgccgcgtggctgtgggagtcaac
gcctgtgtggatgtggtaatctctggcgtgaaactcctgcaggccctcggcctcagtcct
gggagtggaaaagatcatgctattctacactcgagaagtgatctggaagaagccttcctc
tacttcatggggaagggagccgctgctgagcgcttcttcagtgataaagagacctttcat
gacattgcccaggctgcatctgagtttccaggagctcagcattatgtaggaggaaatgct
gctttaattggacagaggtttgctgccaacacagacttaaaggttcttctttgtggtcca
attggcccaaaactgcatgaacttcttgatgacaatgtgtttgttccaccagagtcactg
caggaagaggatgagttccaccttattttagagtacctggcaggggaggagtggggcccg
tttaaagctccccatgccaaccgcttcatcttctctcacgacctctccaacggggccatg
aatatgctggaggtgtttgtgtctagcctggaggagttccagcctgacctggtggtcctt
tctggattgcacatgatggagggacaaagcaaggagctccagaggaagaggctcttggag
gttgtgaccgccatttctgacatccccactggtattccagttcacctagagctggccagt
atgaccaacagggagctcatgagcagtattgtgcatcagcaggtctttcccacggtggct
tctcttgggctgaatgaacaggagctgctgtttctcagccagtcggcatctggaccccat
gcttctctctcctcctgggatggtgttcctgatgtgggcatggtcagtgacatcctcttc
tggatcttgaaagaacatggaaggagtgaaaacagagcctcggatctcaccaggatccat
ttccacacgctggtctaccacattctggcaactgtggacggacactgggccaaccagctc
gcagccgtagctgcgggagctcgtgtagctgggacacaagcctgtgccacagaaaccata
gacaccaaccgagtgtctctaagagcacctcaggagtttacgacatcccatttggaatcc
ggttccaggattgtattgaacccagataagccagtggtggagtggcacagggagggaata
actttccacttcacacctgtgttggtgtgtaaagaccccgttcgaactgtaggccttggt
gatgccatttccgctgaaggcctcttctattcagaagcacgccctgattag

DBGET integrated database retrieval system