KEGG   Mus musculus (house mouse): 72148
Entry
72148             CDS       T01002                                 
Symbol
Tdrp, 2610019F03Rik
Name
(RefSeq) testis development related protein
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TDRP
Other DBs
NCBI-GeneID: 72148
NCBI-ProteinID: NP_776105
MGI: 1919398
Ensembl: ENSMUSG00000050052
Vega: OTTMUSG00000031434
UniProt: Q8C5P7
Position
8:complement(14002008..14025484)
AA seq 182 aa
MWKLSRSRVLLDEPPEEEDVLRGAPPASAAAPASGASLRGWKEATSLFNKDDEEHLLETS
RSPKSKGTNQRLREELKAEKKSGFWDALVLKQNAQPKKPDQIEGWEPPKLTAEDVVADHT
EDDRSGCPPWSAWEDDTKGSTKYTSLANSASSSRWSLRSAGKLVSIRRQSKGHLTETCEE
GE
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtggaagctgagccgaagtcgagtgcttctggacgagccccccgaggaagaggatgtg
ctgcgaggggcaccgccagcatcagcagccgccccggcgtcgggagcaagtctcagaggt
tggaaagaagcaacttctctgtttaataaagatgatgaagaacatctcctcgagacttcc
agatctcctaagtccaaaggaactaaccaacgactaagagaagagctgaaggcagagaag
aaatcaggattttgggacgccttggttttgaaacagaatgcccagcctaaaaaaccagat
cagatcgaaggttgggagcctcccaaacttactgctgaagacgtggtcgccgaccatacc
gaggatgatagaagtggctgcccaccctggtctgcctgggaggacgataccaagggctct
accaagtacaccagcctcgccaactcagccagcagctcccgctggagcctccggtcagcg
ggaaagctggtcagcatcaggcgacagagcaaaggccacctgacagagacctgtgaagag
ggagaatga

DBGET integrated database retrieval system