KEGG   Mus musculus (house mouse): 72149
Entry
72149             CDS       T01002                                 
Symbol
Strada, 2610019A05Rik, 6030402H20Rik, AI480680, E130112C09Rik
Name
(RefSeq) STE20-related kinase adaptor alpha
  KO
K08271  STE20-related kinase adapter protein alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    72149 (Strada)
   04150 mTOR signaling pathway
    72149 (Strada)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    72149 (Strada)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   72149 (Strada)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 72149
NCBI-ProteinID: NP_001239377
MGI: 1919399
Ensembl: ENSMUSG00000069631
UniProt: Q3UUJ4
Position
11:complement(106053800..106084460)
AA seq 431 aa
MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKANEASSESIASFSKPEMMS
SFLPEGGCYELLTIIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELH
VSKLFSHPNIVPYRATFIADNELWVVTSFMAYGSAKDLIGTHFMDGMNELAIAYILQGVL
KALDYIHHMGYVHRSVKASHILISTDGKVYLSGLRSNLSMISHGQRQRAVHDFPKYSIKV
LPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLL
DTSTIPAEELTMSPSRSIANPGLNDSLAAGSLRPSNGDSPSHPYHRTFSPHFHNFVEQCL
QRNPDARPNASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTN
LEDLEVDDWEF
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgtcttttcttgtaagtaaaccagagcgcattaggcggtgggtctcggaaaagttcatt
gttgagggcttaagagatttggaactgtttggagagcagcctccgggtgacactcggaga
aaagccaatgaggcgagctcagagtccatagcatctttctccaaaccagagatgatgagc
agctttcttccagagggcgggtgttatgagctgctcaccatcataggcaaagggtttgag
gacttgatgacagtgaatttagccaggtacaaaccaacgggagagtatgtgacagtacga
aggatcaacctagaagcttgttccaatgagatggtgacattcttgcagggggagcttcat
gtctctaaactcttcagccatcccaatatagtaccgtatcgagccaccttcatcgcagat
aatgagctgtgggtcgtcacatcatttatggcgtacggctctgcaaaggatctcattggc
acacacttcatggatggcatgaatgaactggcgattgcatacatcctgcagggggtgcta
aaggccttagactacatccatcacatgggctatgtgcacaggagtgtcaaggccagccac
attctgatctccacggatgggaaggtctacctgtctggtttacgcagcaaccttagcatg
attagtcacgggcagcggcagcgtgcagtccacgatttccccaaatatagtatcaaggtc
ctgccttggctcagcccagaagtcctccagcagaatcttcagggttacgatgccaagtcc
gatatctacagtgtgggaatcacagcatgtgaactagccaatggccatgtccccttcaaa
gatatgcctgccactcagatgctgctagaaaaacttaatggcacagtgccctgcctgctg
gacaccagcaccatccctgccgaggagctgaccatgagtccctcccgctccatcgccaac
cctggcctgaatgacagcctggctgctggtagcctccggccttccaatggcgactcgcct
tcccacccctaccaccgaaccttctcgcctcacttccacaactttgtggaacagtgcctt
cagcgcaaccctgacgcaaggccaaacgccagcaccctgctgaaccactccttcttcaag
cagatcaagcggcgtgcttccgaggctttgcctgagttgctccgcccagtcactcccatc
accaacttcgagggcagccagtctcaggatcacagtggaatcttcggcctggtgacaaac
ctagaagacctggaggtggatgactgggagttctga

DBGET integrated database retrieval system