KEGG   Mus musculus (mouse): 72162Help
Entry
72162             CDS       T01002                                 

Gene name
Dhx36, 2810407E23Rik, AI452301, AU022184, Ddx36, mKIAA1488
Definition
(RefSeq) DEAH (Asp-Glu-Ala-His) box polypeptide 36
  KO
K14442  ATP-dependent RNA helicase DHX36 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    72162 (Dhx36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    72162 (Dhx36)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     72162 (Dhx36)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     72162 (Dhx36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 Helicase_C OB_NTP_bind DEAD AAA_22 AAA_19 PhoH ATPase AAA_14 AAA_23 T2SSE
Motif
Other DBs
NCBI-GeneID: 72162
NCBI-ProteinID: NP_082412
MGI: 1919412
Ensembl: ENSMUSG00000027770
Vega: OTTMUSG00000025981
UniProt: Q8VHK9
Position
3; 3 E1
AA seq 1001 aa AA seqDB search
MSYDYHQSWSRDGGPRGSGQGSSGGGGGGSRGSGGGGGGRGGRGRHPAHLKGREIGLWYA
KKQTQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKTDKDSEAQISWFAPEDHGYGTE
VSSEKKINSEKKLDNQEKKLLNQEKKTFRITDKSYIDRDSEYLLQENEPNLSLDQHLLED
LQRKKTDPRYIEMQRFRKKLPSYGMQKELVNLINNHQVTVISGETGCGKTTQVTQFILDN
YIERGKGSACRIVCTQPRRISAISVAERVATERAESCGNGNSTGYQIRLQSRLPRKQGSI
LYCTTGIILQWLQSDSRLSSVSHIVLDEIHERNLQSDVLMTVIKDLLHFRSDLKVILMSA
TLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDIIEKIRYVPDQKEHRSQFKRGFMQGHV
NRQEKEEKEAIYKERWPAYIKELRTRYSASTVDVLQMMDDDKVDLNLIAALIRYIVLEEE
DGAILVFLPGWDNISTLHDLLMSQVMFKSDKFLIIPLHSLMPTVNQTQVFKKTPPGVRKI
VIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQ
PGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMDPPSNEAV
VLSIKHLMELSALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLSF
KDPFVIPLGKEKIADARRKELAKETRSDHLTVVNAFEGWEEAKRRGFRYEKDYCWEYFLS
SNTLQMLHNMKGQFAEHLLGAGFVSSRSPKDPKANINSDNEKIIKAVICAGLYPKVAKIR
LNLGKKRKMVKVHTKSDGLVSIHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLYDCTEVSP
YCLLFFGGDISIQKDKDQEIIAVDEWIVFQSPERIAHLVKGLRKELDSLLQEKIESPHPV
DWDDTKSRDCAVLSAILDLIKTQEKATPRNLPPRSQDGYYS
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgactatcatcagagctggagccgcgatgggggcccacggggctccggccag
ggctccagcggcggcggcggcggagggagccggggctcgggcggcggcggagggggccgc
ggcggccggggccggcatcccgcacaccttaagggtcgcgagatcggcctgtggtacgcc
aagaagcagacgcagaagaacaaggaggctgagaggcaggagagagctgtagtgcacatg
gatgaacgtcgagaagagcaaattgtgcagctgctgaattcagtccaagctaagactgac
aaagattcagaagcgcagatatcctggtttgctcctgaggatcatgggtatggtactgaa
gtttcttcagagaaaaaaataaactcagagaagaaacttgacaaccaggaaaagaaattg
ctaaaccaagaaaaaaagacatttaggatcacagacaaatcatatattgaccgagattct
gagtatttattgcaagaaaatgagccaaacctaagcttagatcaacatttactggaagat
ttacaaaggaaaaaaactgaccctcgatatatagagatgcagcgtttcagaaaaaagctg
ccttcatatggaatgcagaaggagctggtaaatctaatcaataaccatcaggtgacagta
ataagtggtgaaactggttgtggcaaaaccactcaggttacgcagttcatcttggataac
tacatcgaaagaggaaaagggtctgcctgcagaatagtgtgtactcagccgagaagaatt
agtgccatttcagtcgctgagagagtggccacagaaagggcagagtcttgtggcaatggt
aatagtactggataccagattcgtcttcaaagtcggttgccaaggaaacaaggttctatc
ttatactgcacaacaggaatcattcttcagtggctccagtccgactcacgtttgtccagt
gttagtcatattgtacttgatgaaattcatgaaaggaatctacagtcggatgttttaatg
actgttattaaagatcttctccattttcgatctgatctcaaagtaatattgatgagtgca
actttgaatgctgagaaattttcagaatattttggtaactgtccaatgatacatataccc
gggtttacttttccagttgtggaatatcttttggaagatatcattgaaaaaataagatat
gttccagaccaaaaagaacatagatcccagttcaagaggggtttcatgcagggtcatgta
aatagacaagaaaaagaagaaaaagaggccatctataaggaacgctggccagcgtatata
aaggaactgcggacaagatactctgcaagtaccgtagatgttttgcaaatgatggatgat
gataaagttgatctgaatttgattgctgcccttattcgatacattgttttggaagaagag
gatggtgcaatattggtctttctaccaggctgggacaatatcagtactttgcatgatctc
ttgatgtcacaagtgatgtttaaatcagataagtttctcattatacctttacattcactg
atgcctaccgtcaaccagacacaggtatttaaaaaaactcctcccggtgttcggaaaata
gtaattgctaccaacattgcagagactagcatcaccatagatgatgtggtttatgtaata
gatggaggaaaaattaaagaaacacactttgacacacagaacaacatcagtaccatgtct
gctgagtgggttagtaaagctaatgccaaacagaggaaagggagagctggaagagttcag
cctggtcattgttatcatctgtataatggtcttagagcaagtcttctagatgactaccaa
ctaccagaaattttgagaactcctttggaagaactctgtttgcaaataaagatcttgagg
ctgggtggaattgcttattttctgagtagattaatggatccaccatcaaatgaggcagtg
gtgctctccataaaacacctaatggaactgagtgctttggataagcaagaagaattaaca
cctcttggtgtccatttagcccgactgcctgttgagccacatattggaaaaatgattctc
tttggagctttgttctgctgcttagatccagttctcaccattgctgccagtctcagcttt
aaagatccctttgtcattccattgggaaaagaaaagattgcagatgcaagaagaaaagaa
ctggcaaaggaaactagaagtgatcacctgacagttgtgaatgcatttgagggctgggaa
gaagccaaacgacgtggtttcaggtatgaaaaggactactgctgggaatattttctgtct
tcgaacacactacagatgctgcataacatgaagggacagtttgctgagcatcttcttgga
gctggatttgtaagcagtagaagtcccaaagatccaaaagctaatataaattcagataat
gagaagataattaaagctgtcatctgtgctggtttatatcccaaagttgctaaaatccga
ctaaatttgggtaaaaagaggaaaatggtaaaagttcacacgaagtctgacggcctggtt
tctattcatcctaagtctgtcaacgtggagcagacagacttccactacaactggcttatc
tatcacctgaagatgagaacaagcagtatatacttgtacgactgtacagaagtgtcacca
tactgcctcctgttctttggaggagatatttccatccagaaagataaggatcaggaaatt
attgctgtagatgagtggattgtgtttcagtctccagaaagaattgcccatcttgttaag
ggactaagaaaggaactggatagccttctacaagagaagattgaaagccctcatcctgta
gactgggacgacactaagtcaagagactgtgcagtactgtcagctattctagacttgatc
aaaactcaagaaaaggctactccaaggaacttgccaccacggtcacaggacggatattat
agctga

DBGET integrated database retrieval system