KEGG   Mus musculus (mouse): 72169
Entry
72169             CDS       T01002                                 

Gene name
Trim29, 1110047J21Rik, 2810431N19Rik, 4732461M22Rik, AI119726
Definition
(RefSeq) tripartite motif-containing 29
  KO
K12010  tripartite motif-containing protein 29
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    72169 (Trim29)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    72169 (Trim29)
SSDB
Motif
Pfam: zf-B_box MIS13 YliH PSP1
Other DBs
NCBI-GeneID: 72169
NCBI-ProteinID: NP_076144
MGI: 1919419
Ensembl: ENSMUSG00000032013
Vega: OTTMUSG00000063156
UniProt: Q8R2Q0
Position
9; 9 A5.1
AA seq 587 aa
MEGADACRSNGASPEARDTRSPPGPSGSLENGTKADSKDTKTTNGHSGEVTEGKTLGSAL
KSGEGKSGLFSSNEWRRPIIQFVESVDDKGSSYFSMDSAEGRRSPYAGLQLGASKKPPVT
FAEKGELRKSIFSEPRKPTVTIVEPGEVRRNSYPRADSSLLARAKSGSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPLHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDDVEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRELEKQKEEVRAALEQREQDAVDQVKVIVDALDERAKVLHED
KQTREQLHNISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNCKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYMNSYTSSYGNEWSTPDTMKRYSMYLTPKGG
GRTSYQPSSPSRLSKETNQKNFNNLYGTKGNYTSRVWEYTSTVQNSEDMPTVQGNSSFSL
KGFPSLLRSQVPKAQPQTWKSGKQTLLSHYRPFYVNKGSGIGSNEAP
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggaaggtgccgatgcctgcaggagcaatggggccagcccggaagccagggacacccgc
agcccaccgggtcccagcggcagcctagagaatggcactaaagcagacagtaaggacacc
aagacaaccaacgggcacagtggggaggtgacagagggcaagaccctgggcagtgccctg
aagtcaggggaggggaagagtggcctattttccagcaatgagtggcgcaggcctatcatc
cagtttgtggagtctgtcgacgacaaaggctccagttacttcagtatggactctgcggaa
ggcaggaggtccccttatgcggggctccagttgggggcttccaagaaacctcctgtgacc
tttgctgagaagggggagctgcgaaagtccattttctccgagccccgcaaacccacggtg
accatcgtggagcccggggaagtccgcaggaatagctaccccagggctgactccagcctc
ctggcgcgggcaaagtcgggctccgaggaggtgctgtgcgactcctgcatcggcaacaag
cagaaggccgtcaagtcctgcctggtgtgccaggcttccttctgtgagctgcatctgaag
ccccacctggagggcgctgccttccgggaccaccagctgctcgagcccatccgagacttc
gaggcccgaaaatgtcccttgcacggcaagactatggagctcttctgtcagaccgaccag
acctgcatctgttatctctgcatgttccaggagcacaagaaccacagcaccgtgacggtg
gaggaggccaaggcagagaaggagaccgagctgtcactgcaaaaggaacagctgcaactg
aagatcattgagattgaagatgatgttgagaagtggcaaaaggagaaagaccggatcaag
agctttaccaccaacgagaaggcgatcctggagcagaacttcagggacctggtgagggag
ctggagaagcagaaggaggaagtacgggctgcactggagcagcgggagcaggatgctgtg
gaccaagtgaaggtgatcgtggatgctctggatgagagggccaaggtgctgcacgaggac
aagcagacccgagagcagctgcacaacatcagtgactcggtgctgttcctgcaggaattt
ggtgcattgatgagcaattactctctccctccacctctgcccacctaccatgtcctgctg
gagggagaggggctgggacagtctcttggcaactgcaaggatgacctgctcaatgtgtgc
atgcgtcatgttgagaagatgtgcaaggccgatttgagccgcaacttcattgagaggaac
catatggaaaatggtggggaccatcgctacatgaacagctacaccagcagctatgggaac
gagtggagcacgcctgacaccatgaaaagatactccatgtacctcacgcccaagggtggg
ggccggacatcctaccagccatcctcgcctagccgcctctccaaggagaccaaccagaag
aattttaacaatctgtatggcacaaaaggcaactatacctccagggtctgggagtacaca
tccacggttcagaattctgaggatatgcccacggtgcaaggcaactcctccttctccctg
aaaggctttccctccctcctccggagccaagttcccaaggcccagcctcagacttggaaa
tctggcaagcagactctgctgtctcactaccggccattctatgtcaacaagggcagcggc
atcggatccaacgaggcgccctga

DBGET integrated database retrieval system