KEGG   Mus musculus (mouse): 72170Help
Entry
72170             CDS       T01002                                 

Gene name
Chchd4, 2410012P20Rik, 2810014D17Rik, AI838740
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 4
  KO
K17782  mitochondrial intermembrane space import and assembly protein 40
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    72170 (Chchd4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    72170 (Chchd4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Mitochondrial intermembrane space assembly (MIA) complex
    72170 (Chchd4)
Transporters [BR:mmu02000]
 Other transporters
  Primary active transporters [TC:3]
   72170 (Chchd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH GCK Ndufs5
Motif
Other DBs
NCBI-GeneID: 72170
NCBI-ProteinID: NP_598689
MGI: 1919420
Ensembl: ENSMUSG00000034203
Vega: OTTMUSG00000057968
UniProt: Q8VEA4
Position
6; 6 D1
AA seq 139 aa AA seqDB search
MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGDINWNCPCLGGMA
SGPCGEQFKSAFSCFHYSTEDIKGSDCIDQFRAMQECMQKYPDLYPQDEEEEEEAKPVEP
VEETADTKVSAAKEQGTSS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcctactgccggcaggaagggaaggatcggatcatatttgtgaccaaagaagaccat
gaaactcctagcagtgccgagctggtagctgatgaccccaatgatccctatgaggagcac
gggttgatactgcctaacggagatattaactggaattgtccatgtcttgggggaatggcc
agcggcccctgtggggagcagttcaagtctgccttctcctgcttccactacagcacagag
gatatcaaggggtcagactgtatagaccagttccgggccatgcaagagtgcatgcagaag
tacccggacctctatccccaagacgaggaggaggaagaggaggcaaagccagtggagccg
gtggaggagacagctgacactaaggtctctgcagccaaagagcaagggacaagctcttga

DBGET integrated database retrieval system